BLASTX nr result
ID: Papaver25_contig00025519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00025519 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274726.1| PREDICTED: signal peptide peptidase-like 2B ... 65 1e-08 emb|CAN62222.1| hypothetical protein VITISV_022532 [Vitis vinifera] 65 1e-08 gb|EPS63416.1| hypothetical protein M569_11364, partial [Genlise... 57 2e-06 >ref|XP_002274726.1| PREDICTED: signal peptide peptidase-like 2B [Vitis vinifera] gi|297745304|emb|CBI40384.3| unnamed protein product [Vitis vinifera] Length = 534 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 285 MDSRRVLLIIGLVQLCLVQLVFGGDIVHEDDKAPKKPGCSNNFVLVK 425 MDS R LL++ ++ +C + + F GDIVH+DD APKKPGC NNFVLVK Sbjct: 1 MDSPRNLLLLFVLLVCTLTVAFAGDIVHQDDIAPKKPGCENNFVLVK 47 >emb|CAN62222.1| hypothetical protein VITISV_022532 [Vitis vinifera] Length = 489 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 285 MDSRRVLLIIGLVQLCLVQLVFGGDIVHEDDKAPKKPGCSNNFVLVK 425 MDS R LL++ ++ +C + + F GDIVH+DD APKKPGC NNFVLVK Sbjct: 1 MDSPRNLLLLFVLLVCTLTVAFAGDIVHQDDIAPKKPGCENNFVLVK 47 >gb|EPS63416.1| hypothetical protein M569_11364, partial [Genlisea aurea] Length = 437 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 318 LVQLCLVQLVFGGDIVHEDDKAPKKPGCSNNFVLVK 425 LV L +VF GDIVHEDDK+PK+PGC NNFVLVK Sbjct: 1 LVLLVPSSVVFAGDIVHEDDKSPKRPGCDNNFVLVK 36