BLASTX nr result
ID: Papaver25_contig00025075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00025075 (945 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006413246.1| hypothetical protein EUTSA_v10024661mg [Eutr... 49 7e-06 >ref|XP_006413246.1| hypothetical protein EUTSA_v10024661mg [Eutrema salsugineum] gi|557114416|gb|ESQ54699.1| hypothetical protein EUTSA_v10024661mg [Eutrema salsugineum] Length = 637 Score = 48.9 bits (115), Expect(3) = 7e-06 Identities = 27/45 (60%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = +2 Query: 785 SIVICVFGKDAMKLDEYLIAIGERSLETLVTVGK--GVARNKMES 913 S VICVF KD+MK+DE L+A RSLETL+TVG GV+ K+E+ Sbjct: 588 STVICVFEKDSMKIDEDLLANSGRSLETLITVGMQLGVSFPKLEN 632 Score = 23.9 bits (50), Expect(3) = 7e-06 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 579 VALAAIGATMTHRITFFLQ 635 VA AIGATM ITF Q Sbjct: 551 VAFVAIGATMVGSITFVRQ 569 Score = 23.5 bits (49), Expect(3) = 7e-06 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 616 GSPSFFREEDDFVKKG 663 GS +F R+E D VKKG Sbjct: 562 GSITFVRQEGDHVKKG 577