BLASTX nr result
ID: Papaver25_contig00024946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00024946 (1078 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU75330.1| Putative ribosome biogenesis protein/Also GTP-bi... 59 5e-06 gb|EPQ66708.1| hypothetical protein BGT96224_2647B [Blumeria gra... 59 5e-06 ref|XP_002841516.1| hypothetical protein [Tuber melanosporum Mel... 59 5e-06 ref|XP_001224118.1| hypothetical protein CHGG_04904 [Chaetomium ... 58 8e-06 ref|XP_004309829.1| PREDICTED: ribosome biogenesis protein BMS1 ... 58 8e-06 ref|XP_007199685.1| hypothetical protein PRUPE_ppa000398mg [Prun... 58 8e-06 >emb|CCU75330.1| Putative ribosome biogenesis protein/Also GTP-binding protein [Blumeria graminis f. sp. hordei DH14] Length = 1128 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = -2 Query: 1077 NQAEKIVMGCRRKGTPYKIIGNTALIKDVFKSDIDVARHKTALIKTASGVRGRVVEA 907 ++ +IV + GTPYKI NTA IKD+F S +++A+ + A IKT SGVRG++ +A Sbjct: 874 DEVSEIVKKLKLTGTPYKIFKNTAFIKDMFTSSVEIAKFEGAAIKTVSGVRGQIKKA 930 >gb|EPQ66708.1| hypothetical protein BGT96224_2647B [Blumeria graminis f. sp. tritici 96224] Length = 612 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = -2 Query: 1077 NQAEKIVMGCRRKGTPYKIIGNTALIKDVFKSDIDVARHKTALIKTASGVRGRVVEA 907 ++ +IV + GTPYKI NTA IKD+F S +++A+ + A IKT SGVRG++ +A Sbjct: 358 DEVSEIVKKLKLTGTPYKIFKNTAFIKDMFTSSVEIAKFEGAAIKTVSGVRGQIKKA 414 >ref|XP_002841516.1| hypothetical protein [Tuber melanosporum Mel28] gi|295637756|emb|CAZ85707.1| unnamed protein product [Tuber melanosporum] Length = 1179 Score = 58.5 bits (140), Expect = 5e-06 Identities = 28/60 (46%), Positives = 41/60 (68%) Frame = -2 Query: 1077 NQAEKIVMGCRRKGTPYKIIGNTALIKDVFKSDIDVARHKTALIKTASGVRGRVVEAFVH 898 +Q+ +IV + GTPYKI NTA IKD+F S ++VA+ + A I+T SGVRG++ A + Sbjct: 908 DQSTEIVKKLKLTGTPYKIFKNTAFIKDMFNSSLEVAKFEGASIRTVSGVRGQIKRALAN 967 >ref|XP_001224118.1| hypothetical protein CHGG_04904 [Chaetomium globosum CBS 148.51] gi|88180817|gb|EAQ88285.1| hypothetical protein CHGG_04904 [Chaetomium globosum CBS 148.51] Length = 1102 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/57 (45%), Positives = 40/57 (70%) Frame = -2 Query: 1077 NQAEKIVMGCRRKGTPYKIIGNTALIKDVFKSDIDVARHKTALIKTASGVRGRVVEA 907 +++ +IV + GTPYKI NTA IKD+F S +++A+ + A IKT SG+RG++ A Sbjct: 897 DESTEIVKKLKLTGTPYKIFKNTAFIKDMFNSSLEIAKFEGAAIKTVSGIRGQIKRA 953 >ref|XP_004309829.1| PREDICTED: ribosome biogenesis protein BMS1 homolog [Fragaria vesca subsp. vesca] Length = 1211 Score = 57.8 bits (138), Expect = 8e-06 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = -2 Query: 1077 NQAEKIVMGCRRKGTPYKIIGNTALIKDVFKSDIDVARHKTALIKTASGVRGRVVEA 907 N A +IV + G P KI NTALIKD+F SD+++AR + A ++T SG+RG+V +A Sbjct: 944 NHASRIVKKLKLVGYPCKIFKNTALIKDMFTSDLEIARFEGASVRTVSGIRGQVKKA 1000 >ref|XP_007199685.1| hypothetical protein PRUPE_ppa000398mg [Prunus persica] gi|462395085|gb|EMJ00884.1| hypothetical protein PRUPE_ppa000398mg [Prunus persica] Length = 1208 Score = 57.8 bits (138), Expect = 8e-06 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = -2 Query: 1077 NQAEKIVMGCRRKGTPYKIIGNTALIKDVFKSDIDVARHKTALIKTASGVRGRVVEA 907 N A +IV + G P KI NTAL+KD+F SD+++AR + A ++T SG+RG+V +A Sbjct: 941 NHASRIVKKLKLVGHPCKIFKNTALVKDMFTSDLEIARFEGAAVRTVSGIRGQVKKA 997