BLASTX nr result
ID: Papaver25_contig00024868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00024868 (498 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36657.1| C3HL domain class transcription factor [Malus dom... 69 7e-10 ref|XP_002277632.2| PREDICTED: zinc finger CCCH domain-containin... 64 2e-08 emb|CBI15944.3| unnamed protein product [Vitis vinifera] 64 2e-08 emb|CAN78824.1| hypothetical protein VITISV_006556 [Vitis vinifera] 64 2e-08 ref|XP_006425080.1| hypothetical protein CICLE_v10027883mg [Citr... 64 3e-08 ref|XP_006425079.1| hypothetical protein CICLE_v10027883mg [Citr... 64 3e-08 ref|XP_007016084.1| Zinc finger family protein [Theobroma cacao]... 64 3e-08 ref|XP_006488540.1| PREDICTED: zinc finger CCCH domain-containin... 63 4e-08 ref|XP_006488539.1| PREDICTED: zinc finger CCCH domain-containin... 63 4e-08 ref|XP_002314096.2| hypothetical protein POPTR_0009s05150g [Popu... 62 8e-08 ref|XP_002299802.2| hypothetical protein POPTR_0001s25960g [Popu... 61 1e-07 ref|XP_007208332.1| hypothetical protein PRUPE_ppa002251mg [Prun... 61 2e-07 ref|XP_004294290.1| PREDICTED: zinc finger CCCH domain-containin... 57 3e-06 ref|XP_002525655.1| transcription factor, putative [Ricinus comm... 55 8e-06 >gb|ADL36657.1| C3HL domain class transcription factor [Malus domestica] Length = 706 Score = 68.9 bits (167), Expect = 7e-10 Identities = 37/72 (51%), Positives = 47/72 (65%) Frame = -3 Query: 481 SPPETMASLAHPGDEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMD 302 S P + + GDEPDVSWVQSLVKD PQ S + +F E+QQ Q+Q H N+GG + Sbjct: 633 SSPTASSMMPTNGDEPDVSWVQSLVKDGPQAS-QQRGQFGFEDQQ---QQQCHPNNGGPE 688 Query: 301 MLSPYMEQLYME 266 ML ++EQLY E Sbjct: 689 MLPAWVEQLYFE 700 >ref|XP_002277632.2| PREDICTED: zinc finger CCCH domain-containing protein 66-like isoform 1 [Vitis vinifera] Length = 693 Score = 63.9 bits (154), Expect = 2e-08 Identities = 37/66 (56%), Positives = 45/66 (68%) Frame = -3 Query: 463 ASLAHPGDEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMDMLSPYM 284 AS+ DEPDVSWVQSLVK+AP S P +F EEQ QYHLNSGG ++L P++ Sbjct: 630 ASVPAAADEPDVSWVQSLVKEAP--SARP-GQFGYEEQH-----QYHLNSGGSEILPPWV 681 Query: 283 EQLYME 266 EQL +E Sbjct: 682 EQLCVE 687 >emb|CBI15944.3| unnamed protein product [Vitis vinifera] Length = 752 Score = 63.9 bits (154), Expect = 2e-08 Identities = 37/66 (56%), Positives = 45/66 (68%) Frame = -3 Query: 463 ASLAHPGDEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMDMLSPYM 284 AS+ DEPDVSWVQSLVK+AP S P +F EEQ QYHLNSGG ++L P++ Sbjct: 689 ASVPAAADEPDVSWVQSLVKEAP--SARP-GQFGYEEQH-----QYHLNSGGSEILPPWV 740 Query: 283 EQLYME 266 EQL +E Sbjct: 741 EQLCVE 746 >emb|CAN78824.1| hypothetical protein VITISV_006556 [Vitis vinifera] Length = 893 Score = 63.9 bits (154), Expect = 2e-08 Identities = 37/66 (56%), Positives = 45/66 (68%) Frame = -3 Query: 463 ASLAHPGDEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMDMLSPYM 284 AS+ DEPDVSWVQSLVK+AP S P +F EEQ QYHLNSGG ++L P++ Sbjct: 830 ASVPAAADEPDVSWVQSLVKEAP--SARP-GQFGYEEQH-----QYHLNSGGSEILPPWV 881 Query: 283 EQLYME 266 EQL +E Sbjct: 882 EQLCVE 887 >ref|XP_006425080.1| hypothetical protein CICLE_v10027883mg [Citrus clementina] gi|557527014|gb|ESR38320.1| hypothetical protein CICLE_v10027883mg [Citrus clementina] Length = 741 Score = 63.5 bits (153), Expect = 3e-08 Identities = 38/74 (51%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = -3 Query: 484 GSPPETMASLAHPGDEPDVSWVQSLVKDAPQ-QSGSPKRRFSLEEQQIQMQKQYHLNSGG 308 GS + S DEPDVSWVQSLV+D+P +SG +F EEQQ HLNSGG Sbjct: 672 GSVATSETSTPATADEPDVSWVQSLVRDSPSIRSG----QFGFEEQQC------HLNSGG 721 Query: 307 MDMLSPYMEQLYME 266 +ML ++EQLYME Sbjct: 722 SEMLPAWVEQLYME 735 >ref|XP_006425079.1| hypothetical protein CICLE_v10027883mg [Citrus clementina] gi|557527013|gb|ESR38319.1| hypothetical protein CICLE_v10027883mg [Citrus clementina] Length = 705 Score = 63.5 bits (153), Expect = 3e-08 Identities = 38/74 (51%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = -3 Query: 484 GSPPETMASLAHPGDEPDVSWVQSLVKDAPQ-QSGSPKRRFSLEEQQIQMQKQYHLNSGG 308 GS + S DEPDVSWVQSLV+D+P +SG +F EEQQ HLNSGG Sbjct: 636 GSVATSETSTPATADEPDVSWVQSLVRDSPSIRSG----QFGFEEQQC------HLNSGG 685 Query: 307 MDMLSPYMEQLYME 266 +ML ++EQLYME Sbjct: 686 SEMLPAWVEQLYME 699 >ref|XP_007016084.1| Zinc finger family protein [Theobroma cacao] gi|508786447|gb|EOY33703.1| Zinc finger family protein [Theobroma cacao] Length = 709 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/65 (52%), Positives = 42/65 (64%) Frame = -3 Query: 460 SLAHPGDEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMDMLSPYME 281 S+ DEPDVSWVQSLVKD P +F +E+Q +Q HLNSGG +ML ++E Sbjct: 648 SMLPTADEPDVSWVQSLVKDTPSAG-----QFGFDEEQ----QQCHLNSGGAEMLPAWVE 698 Query: 280 QLYME 266 QLYME Sbjct: 699 QLYME 703 >ref|XP_006488540.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like isoform X2 [Citrus sinensis] Length = 705 Score = 63.2 bits (152), Expect = 4e-08 Identities = 38/74 (51%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Frame = -3 Query: 484 GSPPETMASLAHPGDEPDVSWVQSLVKDAPQ-QSGSPKRRFSLEEQQIQMQKQYHLNSGG 308 GS + S DEPDVSWVQSLV+D+P SG +F EEQQ HLNSGG Sbjct: 636 GSVATSETSTPATADEPDVSWVQSLVRDSPSIMSG----QFGFEEQQC------HLNSGG 685 Query: 307 MDMLSPYMEQLYME 266 +ML ++EQLYME Sbjct: 686 SEMLPAWVEQLYME 699 >ref|XP_006488539.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like isoform X1 [Citrus sinensis] Length = 774 Score = 63.2 bits (152), Expect = 4e-08 Identities = 38/74 (51%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Frame = -3 Query: 484 GSPPETMASLAHPGDEPDVSWVQSLVKDAPQ-QSGSPKRRFSLEEQQIQMQKQYHLNSGG 308 GS + S DEPDVSWVQSLV+D+P SG +F EEQQ HLNSGG Sbjct: 705 GSVATSETSTPATADEPDVSWVQSLVRDSPSIMSG----QFGFEEQQC------HLNSGG 754 Query: 307 MDMLSPYMEQLYME 266 +ML ++EQLYME Sbjct: 755 SEMLPAWVEQLYME 768 >ref|XP_002314096.2| hypothetical protein POPTR_0009s05150g [Populus trichocarpa] gi|550331064|gb|EEE88051.2| hypothetical protein POPTR_0009s05150g [Populus trichocarpa] Length = 703 Score = 62.0 bits (149), Expect = 8e-08 Identities = 36/66 (54%), Positives = 41/66 (62%) Frame = -3 Query: 463 ASLAHPGDEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMDMLSPYM 284 AS+ DEPDVSWVQSLVKD P +SG EEQQ Q HLN GG + L ++ Sbjct: 641 ASVPATVDEPDVSWVQSLVKDTPAKSGP----LGFEEQQ-----QCHLNIGGSETLPAWV 691 Query: 283 EQLYME 266 EQLYME Sbjct: 692 EQLYME 697 >ref|XP_002299802.2| hypothetical protein POPTR_0001s25960g [Populus trichocarpa] gi|550348197|gb|EEE84607.2| hypothetical protein POPTR_0001s25960g [Populus trichocarpa] Length = 704 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/66 (53%), Positives = 42/66 (63%) Frame = -3 Query: 463 ASLAHPGDEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMDMLSPYM 284 AS+ EPDVSWVQSLVKD P P LE+QQ Q+Q HLN GG +ML ++ Sbjct: 639 ASVPATVGEPDVSWVQSLVKDTPPVKPGP---LGLEQQQ---QQQCHLNIGGSEMLPAWV 692 Query: 283 EQLYME 266 EQLY+E Sbjct: 693 EQLYIE 698 >ref|XP_007208332.1| hypothetical protein PRUPE_ppa002251mg [Prunus persica] gi|462403974|gb|EMJ09531.1| hypothetical protein PRUPE_ppa002251mg [Prunus persica] Length = 695 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/59 (55%), Positives = 41/59 (69%) Frame = -3 Query: 442 DEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMDMLSPYMEQLYME 266 DEPDVSWVQSLVKDAP S ++ E+QQ Q Q H N+GG +ML ++EQLY+E Sbjct: 636 DEPDVSWVQSLVKDAPPP--SQLGQYGFEDQQ---QPQCHPNNGGPEMLPAWVEQLYLE 689 >ref|XP_004294290.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like [Fragaria vesca subsp. vesca] Length = 701 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = -3 Query: 442 DEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGMDMLSPYMEQLYME 266 DEPDVSWV +LVKDAP S F EEQQ Q+Q HL +G ++LS ++EQLY+E Sbjct: 642 DEPDVSWVNTLVKDAPPPSRPGPLGF--EEQQ---QQQCHLENGDAEILSAWVEQLYLE 695 >ref|XP_002525655.1| transcription factor, putative [Ricinus communis] gi|223535091|gb|EEF36773.1| transcription factor, putative [Ricinus communis] Length = 702 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/73 (45%), Positives = 41/73 (56%) Frame = -3 Query: 484 GSPPETMASLAHPGDEPDVSWVQSLVKDAPQQSGSPKRRFSLEEQQIQMQKQYHLNSGGM 305 G SL + PDVSWVQSLVKDAP S R+ EEQQ Q HLN+G Sbjct: 632 GGAGAAATSLPATLNAPDVSWVQSLVKDAPSTS---PRQLGFEEQQ-----QCHLNTGNS 683 Query: 304 DMLSPYMEQLYME 266 ++ ++EQLY+E Sbjct: 684 EIFPAWVEQLYIE 696