BLASTX nr result
ID: Papaver25_contig00024303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00024303 (527 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451408.1| hypothetical protein CICLE_v10009919mg [Citr... 59 9e-07 >ref|XP_006451408.1| hypothetical protein CICLE_v10009919mg [Citrus clementina] gi|557554634|gb|ESR64648.1| hypothetical protein CICLE_v10009919mg [Citrus clementina] Length = 100 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +2 Query: 227 FIQEPATIEKCNELSKQLFYTRLARVISLSYKYCLFYFSIMY 352 +IQEP T+EKCN LSKQLFYTRLAR SL++ Y FS ++ Sbjct: 37 YIQEPPTVEKCNLLSKQLFYTRLARFFSLTFSYLYISFSFLF 78