BLASTX nr result
ID: Papaver25_contig00023916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00023916 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850129.1| hypothetical protein AMTR_s00022p00230580 [A... 57 2e-06 >ref|XP_006850129.1| hypothetical protein AMTR_s00022p00230580 [Amborella trichopoda] gi|548853727|gb|ERN11710.1| hypothetical protein AMTR_s00022p00230580 [Amborella trichopoda] Length = 80 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -2 Query: 415 GEKKYRYIKLGFYLSLFCIVIFRLVRAAVLAVLTEDDDLR 296 GEKKYR +KL FYL+LF +V+FRLV AAV A+L EDD L+ Sbjct: 36 GEKKYRMVKLAFYLTLFFVVMFRLVGAAVTAILDEDDGLQ 75