BLASTX nr result
ID: Papaver25_contig00023806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00023806 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007033756.1| Mitochondrial ribosomal protein L51/S25/CI-B... 111 9e-23 ref|XP_006856003.1| hypothetical protein AMTR_s00059p00033240 [A... 110 3e-22 ref|XP_007225856.1| hypothetical protein PRUPE_ppa013515mg [Prun... 107 2e-21 ref|XP_002276080.1| PREDICTED: 60S ribosomal protein L51, mitoch... 107 2e-21 ref|XP_007135383.1| hypothetical protein PHAVU_010G124900g [Phas... 105 8e-21 ref|XP_006442823.1| hypothetical protein CICLE_v10022904mg [Citr... 105 8e-21 ref|XP_006376432.1| hypothetical protein POPTR_0013s12990g [Popu... 103 2e-20 ref|XP_003550025.1| PREDICTED: 54S ribosomal protein L51, mitoch... 102 4e-20 gb|ABK93645.1| unknown [Populus trichocarpa] 102 4e-20 ref|XP_004307035.1| PREDICTED: 54S ribosomal protein L51, mitoch... 102 5e-20 ref|XP_004307034.1| PREDICTED: 54S ribosomal protein L51, mitoch... 102 5e-20 gb|AFK38190.1| unknown [Medicago truncatula] 102 7e-20 ref|XP_002530576.1| 60S ribosomal protein L51, putative [Ricinus... 102 7e-20 gb|AFK49105.1| unknown [Lotus japonicus] 101 1e-19 ref|XP_003627415.1| Mitochondrial ribosomal protein L43 [Medicag... 100 2e-19 ref|XP_004985267.1| PREDICTED: 54S ribosomal protein L51, mitoch... 100 2e-19 ref|XP_004510556.1| PREDICTED: 54S ribosomal protein L51, mitoch... 100 2e-19 ref|NP_191524.1| mitochondrial ribosomal protein L51/S25/CI-B8 f... 100 2e-19 ref|XP_002876517.1| mitochondrial ribosomal protein L51/S25/CI-B... 100 2e-19 ref|XP_004496232.1| PREDICTED: 54S ribosomal protein L51, mitoch... 99 5e-19 >ref|XP_007033756.1| Mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Theobroma cacao] gi|508712785|gb|EOY04682.1| Mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Theobroma cacao] Length = 119 Score = 111 bits (278), Expect = 9e-23 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKNKNERV+CV+N+TPED+L HA+RLRNALGRKV+KLKTRHVTKHPSVQGTWT D KF Sbjct: 62 YKNKNERVICVKNMTPEDILLHASRLRNALGRKVVKLKTRHVTKHPSVQGTWTTDVKF 119 >ref|XP_006856003.1| hypothetical protein AMTR_s00059p00033240 [Amborella trichopoda] gi|548859862|gb|ERN17470.1| hypothetical protein AMTR_s00059p00033240 [Amborella trichopoda] Length = 119 Score = 110 bits (274), Expect = 3e-22 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKNKNERVVCV+N+ PED+L HATRLRNALGRKVIKL+TRHVTKHPSVQGTWT D KF Sbjct: 62 YKNKNERVVCVKNMKPEDILLHATRLRNALGRKVIKLRTRHVTKHPSVQGTWTKDLKF 119 >ref|XP_007225856.1| hypothetical protein PRUPE_ppa013515mg [Prunus persica] gi|462422792|gb|EMJ27055.1| hypothetical protein PRUPE_ppa013515mg [Prunus persica] Length = 119 Score = 107 bits (267), Expect = 2e-21 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -3 Query: 431 LYKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 LYKNK+ERVVCV+N+ PE+VL++ATRLRN+LGRKV+KLKTRHVTKHPSVQGTWT D KF Sbjct: 61 LYKNKSERVVCVKNMDPEEVLQYATRLRNSLGRKVVKLKTRHVTKHPSVQGTWTTDVKF 119 >ref|XP_002276080.1| PREDICTED: 60S ribosomal protein L51, mitochondrial isoform 1 [Vitis vinifera] gi|225434100|ref|XP_002276106.1| PREDICTED: 60S ribosomal protein L51, mitochondrial isoform 2 [Vitis vinifera] gi|147861396|emb|CAN83982.1| hypothetical protein VITISV_001097 [Vitis vinifera] gi|296084281|emb|CBI24669.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 107 bits (267), Expect = 2e-21 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWT 270 YKNKNERV+CV+N+TPEDVL HATRLRNALGRKV+KLKTRHVTKHPSVQGTWT Sbjct: 62 YKNKNERVICVKNMTPEDVLHHATRLRNALGRKVLKLKTRHVTKHPSVQGTWT 114 >ref|XP_007135383.1| hypothetical protein PHAVU_010G124900g [Phaseolus vulgaris] gi|561008428|gb|ESW07377.1| hypothetical protein PHAVU_010G124900g [Phaseolus vulgaris] Length = 119 Score = 105 bits (261), Expect = 8e-21 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKNKN+RV+CV+N+ PED+L HATRLRNALGRKV+KL+TRHVTKHPSVQGTWT K+ Sbjct: 62 YKNKNQRVICVKNMDPEDILLHATRLRNALGRKVVKLRTRHVTKHPSVQGTWTTSVKY 119 >ref|XP_006442823.1| hypothetical protein CICLE_v10022904mg [Citrus clementina] gi|567900672|ref|XP_006442824.1| hypothetical protein CICLE_v10022904mg [Citrus clementina] gi|567900674|ref|XP_006442825.1| hypothetical protein CICLE_v10022904mg [Citrus clementina] gi|568849776|ref|XP_006478616.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform X1 [Citrus sinensis] gi|568849778|ref|XP_006478617.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform X2 [Citrus sinensis] gi|568849780|ref|XP_006478618.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform X3 [Citrus sinensis] gi|568849782|ref|XP_006478619.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform X4 [Citrus sinensis] gi|557545085|gb|ESR56063.1| hypothetical protein CICLE_v10022904mg [Citrus clementina] gi|557545086|gb|ESR56064.1| hypothetical protein CICLE_v10022904mg [Citrus clementina] gi|557545087|gb|ESR56065.1| hypothetical protein CICLE_v10022904mg [Citrus clementina] Length = 119 Score = 105 bits (261), Expect = 8e-21 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -3 Query: 431 LYKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 LY+NKNERV+CV+NLTPE++ HATRLRNALGRKV+KLKTRHVTKHPSVQGTW+ KF Sbjct: 61 LYRNKNERVICVKNLTPEEIHLHATRLRNALGRKVVKLKTRHVTKHPSVQGTWSTALKF 119 >ref|XP_006376432.1| hypothetical protein POPTR_0013s12990g [Populus trichocarpa] gi|550325708|gb|ERP54229.1| hypothetical protein POPTR_0013s12990g [Populus trichocarpa] Length = 172 Score = 103 bits (258), Expect = 2e-20 Identities = 49/58 (84%), Positives = 51/58 (87%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKNKNERVVCV+NL EDVL HATRLRNALGRKV KL TRHVTKHPSVQGTWT D +F Sbjct: 115 YKNKNERVVCVKNLVSEDVLLHATRLRNALGRKVKKLPTRHVTKHPSVQGTWTTDVRF 172 >ref|XP_003550025.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Glycine max] Length = 119 Score = 102 bits (255), Expect = 4e-20 Identities = 44/58 (75%), Positives = 53/58 (91%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKNKN+RV+CV+N+ PED+L HATRLRNALGRKV+KL+TRHVTKHPSVQGTWT ++ Sbjct: 62 YKNKNQRVICVKNMDPEDILLHATRLRNALGRKVVKLRTRHVTKHPSVQGTWTTAVEY 119 >gb|ABK93645.1| unknown [Populus trichocarpa] Length = 119 Score = 102 bits (255), Expect = 4e-20 Identities = 48/58 (82%), Positives = 51/58 (87%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKNKNERVVCV+NL EDVL HAT+LRNALGRKV KL TRHVTKHPSVQGTWT D +F Sbjct: 62 YKNKNERVVCVKNLVSEDVLLHATKLRNALGRKVKKLPTRHVTKHPSVQGTWTTDVRF 119 >ref|XP_004307035.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 2 [Fragaria vesca subsp. vesca] gi|470142691|ref|XP_004307036.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 3 [Fragaria vesca subsp. vesca] gi|470142693|ref|XP_004307037.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 4 [Fragaria vesca subsp. vesca] Length = 119 Score = 102 bits (254), Expect = 5e-20 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = -3 Query: 431 LYKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 LY N+NERVVCV+N+ PE+VL+ ATRLRN+LGRKV+KL+TRHVTKHPSVQGTWT D KF Sbjct: 61 LYNNQNERVVCVKNMDPEEVLQCATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTDIKF 119 >ref|XP_004307034.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like isoform 1 [Fragaria vesca subsp. vesca] Length = 124 Score = 102 bits (254), Expect = 5e-20 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = -3 Query: 431 LYKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 LY N+NERVVCV+N+ PE+VL+ ATRLRN+LGRKV+KL+TRHVTKHPSVQGTWT D KF Sbjct: 66 LYNNQNERVVCVKNMDPEEVLQCATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTDIKF 124 >gb|AFK38190.1| unknown [Medicago truncatula] Length = 119 Score = 102 bits (253), Expect = 7e-20 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKN+N+RVVCV+N+ PE++L HATRLRNALGRKVIKL+TRHVTKHPSVQGTWT K+ Sbjct: 62 YKNRNDRVVCVKNMDPEEILLHATRLRNALGRKVIKLRTRHVTKHPSVQGTWTTALKY 119 >ref|XP_002530576.1| 60S ribosomal protein L51, putative [Ricinus communis] gi|223529875|gb|EEF31806.1| 60S ribosomal protein L51, putative [Ricinus communis] Length = 119 Score = 102 bits (253), Expect = 7e-20 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKNKNERVVCV+NLTP++VL ATRLRN+LGRKV+KLKTRHVT+HPSVQGTWT +F Sbjct: 62 YKNKNERVVCVKNLTPDEVLLQATRLRNSLGRKVVKLKTRHVTQHPSVQGTWTTAVRF 119 >gb|AFK49105.1| unknown [Lotus japonicus] Length = 119 Score = 101 bits (251), Expect = 1e-19 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 Y+NKN+RVVCV+NL PED+L ATRLRNALGRKVIKL+TRHVTKHPSVQGTWT K+ Sbjct: 62 YENKNQRVVCVKNLDPEDILLQATRLRNALGRKVIKLRTRHVTKHPSVQGTWTTAVKY 119 >ref|XP_003627415.1| Mitochondrial ribosomal protein L43 [Medicago truncatula] gi|355521437|gb|AET01891.1| Mitochondrial ribosomal protein L43 [Medicago truncatula] Length = 119 Score = 100 bits (250), Expect = 2e-19 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKN N+RVVCV+N+ PE++L HATRLRNALGRKVIKL+TRHVTKHPSVQGTWT K+ Sbjct: 62 YKNHNDRVVCVKNMDPEEILLHATRLRNALGRKVIKLRTRHVTKHPSVQGTWTTALKY 119 >ref|XP_004985267.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Setaria italica] Length = 119 Score = 100 bits (249), Expect = 2e-19 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -3 Query: 431 LYKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTK 258 +YKN NERVVCVRNL PED+L ATRLRN+LGRKV+KL+TRHVTK PSVQGTWT D K Sbjct: 61 IYKNHNERVVCVRNLPPEDILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTDLK 118 >ref|XP_004510556.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Cicer arietinum] Length = 119 Score = 100 bits (249), Expect = 2e-19 Identities = 47/58 (81%), Positives = 51/58 (87%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKN NERVVCVRN+ E+VL HATRLRNALGRKVIKL+TRHVTKHPSVQGTWT K+ Sbjct: 62 YKNHNERVVCVRNMDAEEVLLHATRLRNALGRKVIKLRTRHVTKHPSVQGTWTTALKY 119 >ref|NP_191524.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] gi|6996301|emb|CAB75462.1| putative protein [Arabidopsis thaliana] gi|21617971|gb|AAM67021.1| unknown [Arabidopsis thaliana] gi|27808540|gb|AAO24550.1| At3g59650 [Arabidopsis thaliana] gi|110743592|dbj|BAE99633.1| hypothetical protein [Arabidopsis thaliana] gi|332646429|gb|AEE79950.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis thaliana] Length = 119 Score = 100 bits (249), Expect = 2e-19 Identities = 44/59 (74%), Positives = 54/59 (91%) Frame = -3 Query: 431 LYKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 +Y+N+NERVVCV+N+ PE+VL +ATRLRN+LGRKV+KL+TRHVTKHPSVQGTWT KF Sbjct: 61 IYRNRNERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTAVKF 119 >ref|XP_002876517.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis lyrata subsp. lyrata] gi|565468360|ref|XP_006292060.1| hypothetical protein CARUB_v10018255mg [Capsella rubella] gi|297322355|gb|EFH52776.1| mitochondrial ribosomal protein L51/S25/CI-B8 family protein [Arabidopsis lyrata subsp. lyrata] gi|482560767|gb|EOA24958.1| hypothetical protein CARUB_v10018255mg [Capsella rubella] Length = 119 Score = 100 bits (249), Expect = 2e-19 Identities = 44/59 (74%), Positives = 54/59 (91%) Frame = -3 Query: 431 LYKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 +Y+N+NERVVCV+N+ PE+VL +ATRLRN+LGRKV+KL+TRHVTKHPSVQGTWT KF Sbjct: 61 IYRNRNERVVCVKNMDPEEVLLNATRLRNSLGRKVVKLRTRHVTKHPSVQGTWTTAVKF 119 >ref|XP_004496232.1| PREDICTED: 54S ribosomal protein L51, mitochondrial-like [Cicer arietinum] Length = 119 Score = 99.4 bits (246), Expect = 5e-19 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -3 Query: 428 YKNKNERVVCVRNLTPEDVLKHATRLRNALGRKVIKLKTRHVTKHPSVQGTWTPDTKF 255 YKN+N RVVCVRN+ E+VL HATRLRNALGRKVIKL+TRHVTKHPSVQGTWT K+ Sbjct: 62 YKNQNHRVVCVRNMDAEEVLLHATRLRNALGRKVIKLRTRHVTKHPSVQGTWTTALKY 119