BLASTX nr result
ID: Papaver25_contig00023490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00023490 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040 ... 56 4e-06 ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [S... 56 4e-06 ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427 [S... 56 4e-06 >ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor] gi|241947124|gb|EES20269.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor] Length = 1822 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -2 Query: 467 PKFTKCVFLFCYSPIHKGYKCYDLQTKKTYIFVHVNFDENCFPF 336 P+ T CVFL YSP HKGY+CYDL +++ I HV FDE+ FPF Sbjct: 1065 PRSTLCVFLG-YSPDHKGYRCYDLTSRRVLISRHVVFDESIFPF 1107 >ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor] gi|241928093|gb|EES01238.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor] Length = 1567 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -2 Query: 467 PKFTKCVFLFCYSPIHKGYKCYDLQTKKTYIFVHVNFDENCFPF 336 P+ T CVFL YSP HKGY+CYDL +++ I HV FDE+ FPF Sbjct: 815 PRSTLCVFLG-YSPDHKGYRCYDLTSRRVLISRHVVFDESIFPF 857 >ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor] gi|241923573|gb|EER96717.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor] Length = 1575 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -2 Query: 467 PKFTKCVFLFCYSPIHKGYKCYDLQTKKTYIFVHVNFDENCFPF 336 P+ T CVFL YSP HKGY+CYDL +++ I HV FDE+ FPF Sbjct: 818 PRSTLCVFLG-YSPDHKGYRCYDLTSRRVLISRHVVFDESIFPF 860