BLASTX nr result
ID: Papaver25_contig00023362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00023362 (837 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001671696.1| cytochrome f [Carica papaya] gi|193805979|sp... 86 1e-14 ref|YP_001004199.1| cytochrome f [Ranunculus macranthus] gi|6921... 85 3e-14 ref|YP_009024806.1| cytochrome f (chloroplast) [Trigonobalanus d... 84 5e-14 ref|YP_009020233.1| cytochrome f (chloroplast) [Castanopsis echi... 84 5e-14 gb|AHE41484.1| cytochrome f (chloroplast) [Saxifraga stolonifera] 84 5e-14 gb|AHE41483.1| cytochrome f (chloroplast) [Ribes fasciculatum va... 84 5e-14 gb|AHE41482.1| cytochrome f (chloroplast) [Hamamelis mollis] 84 5e-14 gb|AHE41498.1| cytochrome f (chloroplast) [Paeonia obovata] 84 5e-14 ref|YP_008993189.1| cytochrome f (chloroplast) [Magnolia cathcar... 84 5e-14 ref|YP_008994408.1| cytochrome f (chloroplast) [Viviania marifol... 84 5e-14 ref|YP_008994302.1| cytochrome f [Melianthus villosus] gi|527355... 84 5e-14 ref|YP_008963704.1| cytochrome f (chloroplast) [Liquidambar form... 84 5e-14 ref|YP_008814956.1| cytochrome f (chloroplast) [Brassaiopsis hai... 84 5e-14 ref|YP_008814869.1| cytochrome f (chloroplast) [Aralia undulata]... 84 5e-14 ref|YP_008578186.1| cytochrome f (chloroplast) [Stockwellia quad... 84 5e-14 ref|YP_008578101.1| cytochrome f (chloroplast) [Allosyncarpia te... 84 5e-14 ref|YP_008577846.1| cytochrome f (chloroplast) [Corymbia tessell... 84 5e-14 ref|YP_008577676.1| cytochrome f (chloroplast) [Corymbia maculat... 84 5e-14 ref|YP_008577591.1| cytochrome f (chloroplast) [Corymbia gummife... 84 5e-14 ref|YP_008577506.1| cytochrome f (chloroplast) [Eucalyptus eryth... 84 5e-14 >ref|YP_001671696.1| cytochrome f [Carica papaya] gi|193805979|sp|B1A948.1|CYF_CARPA RecName: Full=Apocytochrome f; Flags: Precursor gi|166344145|gb|ABY86795.1| cytochrome f [Carica papaya] Length = 320 Score = 86.3 bits (212), Expect = 1e-14 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDPSRVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPSRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_001004199.1| cytochrome f [Ranunculus macranthus] gi|69217248|gb|AAZ04018.1| cytochrome f [Ranunculus macranthus] gi|85540817|gb|ABC70769.1| cytochrome f [Ranunculus macranthus] Length = 322 Score = 85.1 bits (209), Expect = 3e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDPSRVQGL FFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 278 AEIVLQDPSRVQGLFFFLASVILAQIFLVLKKKQFEKVQLSEMNF 322 >ref|YP_009024806.1| cytochrome f (chloroplast) [Trigonobalanus doichangensis] gi|597710377|gb|AHN16138.1| cytochrome f (chloroplast) [Trigonobalanus doichangensis] Length = 321 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 277 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 321 >ref|YP_009020233.1| cytochrome f (chloroplast) [Castanopsis echinocarpa] gi|589387964|gb|AHL16920.1| cytochrome f (chloroplast) [Castanopsis echinocarpa] Length = 321 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 277 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 321 >gb|AHE41484.1| cytochrome f (chloroplast) [Saxifraga stolonifera] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >gb|AHE41483.1| cytochrome f (chloroplast) [Ribes fasciculatum var. chinense] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >gb|AHE41482.1| cytochrome f (chloroplast) [Hamamelis mollis] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >gb|AHE41498.1| cytochrome f (chloroplast) [Paeonia obovata] Length = 321 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 277 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 321 >ref|YP_008993189.1| cytochrome f (chloroplast) [Magnolia cathcartii] gi|570760199|ref|YP_008993619.1| cytochrome f (chloroplast) [Magnolia odora] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008994408.1| cytochrome f (chloroplast) [Viviania marifolia] gi|540067485|gb|AGV02837.1| cytochrome f (chloroplast) [Viviania marifolia] Length = 321 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 277 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 321 >ref|YP_008994302.1| cytochrome f [Melianthus villosus] gi|527355152|gb|AGS13021.1| cytochrome f [Melianthus villosus] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008963704.1| cytochrome f (chloroplast) [Liquidambar formosana] gi|491650384|gb|AGL13444.1| cytochrome f (chloroplast) [Liquidambar formosana] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008814956.1| cytochrome f (chloroplast) [Brassaiopsis hainla] gi|458599205|gb|AGG39056.1| cytochrome f (chloroplast) [Brassaiopsis hainla] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008814869.1| cytochrome f (chloroplast) [Aralia undulata] gi|458599103|gb|AGG38969.1| cytochrome f (chloroplast) [Aralia undulata] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008578186.1| cytochrome f (chloroplast) [Stockwellia quadrifida] gi|442569434|gb|AGC59595.1| cytochrome f (chloroplast) [Stockwellia quadrifida] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008578101.1| cytochrome f (chloroplast) [Allosyncarpia ternata] gi|442569348|gb|AGC59510.1| cytochrome f (chloroplast) [Allosyncarpia ternata] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008577846.1| cytochrome f (chloroplast) [Corymbia tessellaris] gi|442569090|gb|AGC59255.1| cytochrome f (chloroplast) [Corymbia tessellaris] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008577676.1| cytochrome f (chloroplast) [Corymbia maculata] gi|545718924|ref|YP_008577761.1| cytochrome f (chloroplast) [Corymbia eximia] gi|545719096|ref|YP_008577931.1| cytochrome f (chloroplast) [Angophora floribunda] gi|545719182|ref|YP_008578016.1| cytochrome f (chloroplast) [Angophora costata] gi|442568918|gb|AGC59085.1| cytochrome f (chloroplast) [Corymbia maculata] gi|442569004|gb|AGC59170.1| cytochrome f (chloroplast) [Corymbia eximia] gi|442569176|gb|AGC59340.1| cytochrome f (chloroplast) [Angophora floribunda] gi|442569262|gb|AGC59425.1| cytochrome f (chloroplast) [Angophora costata] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008577591.1| cytochrome f (chloroplast) [Corymbia gummifera] gi|442568832|gb|AGC59000.1| cytochrome f (chloroplast) [Corymbia gummifera] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320 >ref|YP_008577506.1| cytochrome f (chloroplast) [Eucalyptus erythrocorys] gi|442568746|gb|AGC58915.1| cytochrome f (chloroplast) [Eucalyptus erythrocorys] Length = 320 Score = 84.3 bits (207), Expect = 5e-14 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 835 AEIVLQDPSRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 701 AEIVLQDP RVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF Sbjct: 276 AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320