BLASTX nr result
ID: Papaver25_contig00023148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00023148 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851765.1| hypothetical protein AMTR_s00040p00229490 [A... 57 3e-06 ref|XP_007010176.1| Myotubularin-like phosphatases II superfamil... 57 4e-06 ref|XP_006494958.1| PREDICTED: myotubularin-related protein 2-li... 56 6e-06 ref|XP_006436696.1| hypothetical protein CICLE_v100317281mg, par... 56 6e-06 >ref|XP_006851765.1| hypothetical protein AMTR_s00040p00229490 [Amborella trichopoda] gi|548855345|gb|ERN13232.1| hypothetical protein AMTR_s00040p00229490 [Amborella trichopoda] Length = 834 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/38 (78%), Positives = 30/38 (78%) Frame = -1 Query: 115 VLALSS*PLVRLMMNLRSNVDEKLVAALCTQIQGGKGP 2 VLA SS PLV LMMN RSN DEKLVAALCTQI G GP Sbjct: 254 VLARSSQPLVGLMMNSRSNADEKLVAALCTQIAGNNGP 291 >ref|XP_007010176.1| Myotubularin-like phosphatases II superfamily [Theobroma cacao] gi|508727089|gb|EOY18986.1| Myotubularin-like phosphatases II superfamily [Theobroma cacao] Length = 849 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 115 VLALSS*PLVRLMMNLRSNVDEKLVAALCTQIQGGKG 5 VLA SS PLV LMMN+RSN DEKLVAALCTQ+ GKG Sbjct: 275 VLARSSQPLVGLMMNMRSNTDEKLVAALCTQLVDGKG 311 >ref|XP_006494958.1| PREDICTED: myotubularin-related protein 2-like, partial [Citrus sinensis] Length = 374 Score = 56.2 bits (134), Expect = 6e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 115 VLALSS*PLVRLMMNLRSNVDEKLVAALCTQIQGGK 8 VLA SS PLV LMMN+RSN DEKLVA+LCTQ+ GGK Sbjct: 273 VLARSSQPLVGLMMNMRSNADEKLVASLCTQLAGGK 308 >ref|XP_006436696.1| hypothetical protein CICLE_v100317281mg, partial [Citrus clementina] gi|557538892|gb|ESR49936.1| hypothetical protein CICLE_v100317281mg, partial [Citrus clementina] Length = 293 Score = 56.2 bits (134), Expect = 6e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 115 VLALSS*PLVRLMMNLRSNVDEKLVAALCTQIQGGK 8 VLA SS PLV LMMN+RSN DEKLVA+LCTQ+ GGK Sbjct: 166 VLARSSQPLVGLMMNMRSNADEKLVASLCTQLAGGK 201