BLASTX nr result
ID: Papaver25_contig00023096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00023096 (716 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002873006.1| zinc finger family protein [Arabidopsis lyra... 62 2e-07 ref|XP_004293584.1| PREDICTED: uncharacterized protein LOC101307... 61 3e-07 ref|NP_195772.1| C3HC4 type RING finger protein [Arabidopsis tha... 61 4e-07 ref|XP_007016117.1| RING/U-box superfamily protein isoform 2 [Th... 60 7e-07 ref|XP_007016116.1| RING/U-box superfamily protein isoform 1 [Th... 60 7e-07 ref|XP_007025665.1| RING/U-box superfamily protein [Theobroma ca... 60 7e-07 ref|XP_002305807.1| hypothetical protein POPTR_0004s04140g [Popu... 60 7e-07 ref|XP_002269005.2| PREDICTED: uncharacterized protein LOC100244... 60 7e-07 ref|XP_004485751.1| PREDICTED: uncharacterized protein LOC101513... 60 1e-06 gb|AFK44968.1| unknown [Medicago truncatula] 60 1e-06 ref|XP_003637398.1| RING finger protein [Medicago truncatula] gi... 60 1e-06 ref|XP_006398607.1| hypothetical protein EUTSA_v10014523mg [Eutr... 60 1e-06 ref|XP_003593524.1| RING finger protein [Medicago truncatula] gi... 60 1e-06 ref|XP_002309135.2| hypothetical protein POPTR_0006s10050g [Popu... 59 1e-06 gb|EMS55110.1| hypothetical protein TRIUR3_28361 [Triticum urartu] 59 1e-06 ref|NP_001149292.1| RNA-binding protein [Zea mays] gi|195626094|... 59 1e-06 ref|XP_006449317.1| hypothetical protein CICLE_v10016413mg [Citr... 59 2e-06 ref|XP_006449316.1| hypothetical protein CICLE_v10016413mg [Citr... 59 2e-06 ref|XP_006449315.1| hypothetical protein CICLE_v10016413mg [Citr... 59 2e-06 ref|XP_004500248.1| PREDICTED: uncharacterized protein LOC101492... 59 2e-06 >ref|XP_002873006.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297318843|gb|EFH49265.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 242 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = -3 Query: 117 ICINKSLFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 +CIN C+R RARSQSCPFCR SLKRVNSGDLWIYT S Sbjct: 165 MCIN----CYRNWRARSQSCPFCRGSLKRVNSGDLWIYTSS 201 >ref|XP_004293584.1| PREDICTED: uncharacterized protein LOC101307179 [Fragaria vesca subsp. vesca] Length = 253 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 L C+R R RSQSCPFCR SLKRVNSGDLW+YTDS Sbjct: 178 LKCYRDWRTRSQSCPFCRDSLKRVNSGDLWVYTDS 212 >ref|NP_195772.1| C3HC4 type RING finger protein [Arabidopsis thaliana] gi|7327811|emb|CAB82268.1| putative protein [Arabidopsis thaliana] gi|15292803|gb|AAK92770.1| unknown protein [Arabidopsis thaliana] gi|20258865|gb|AAM14104.1| unknown protein [Arabidopsis thaliana] gi|66865962|gb|AAY57615.1| RING finger family protein [Arabidopsis thaliana] gi|332002973|gb|AED90356.1| C3HC4 type RING finger protein [Arabidopsis thaliana] Length = 242 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = -3 Query: 117 ICINKSLFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 +CIN C+R RARSQSCPFCR SLKRVNSGDLWIYT S Sbjct: 165 MCIN----CYRNWRARSQSCPFCRGSLKRVNSGDLWIYTCS 201 >ref|XP_007016117.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao] gi|508786480|gb|EOY33736.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao] Length = 243 Score = 60.1 bits (144), Expect = 7e-07 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 2/34 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTD 4 L C+R R RSQSCPFCR SLKRVNSGDLWIYTD Sbjct: 168 LKCYRDWRGRSQSCPFCRDSLKRVNSGDLWIYTD 201 >ref|XP_007016116.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] gi|508786479|gb|EOY33735.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao] Length = 257 Score = 60.1 bits (144), Expect = 7e-07 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 2/34 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTD 4 L C+R R RSQSCPFCR SLKRVNSGDLWIYTD Sbjct: 182 LKCYRDWRGRSQSCPFCRDSLKRVNSGDLWIYTD 215 >ref|XP_007025665.1| RING/U-box superfamily protein [Theobroma cacao] gi|508781031|gb|EOY28287.1| RING/U-box superfamily protein [Theobroma cacao] Length = 247 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 2/35 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 L C+R R+RSQSCPFCR SLKRVNSGDLW++TDS Sbjct: 172 LKCYREWRSRSQSCPFCRDSLKRVNSGDLWVFTDS 206 >ref|XP_002305807.1| hypothetical protein POPTR_0004s04140g [Populus trichocarpa] gi|222848771|gb|EEE86318.1| hypothetical protein POPTR_0004s04140g [Populus trichocarpa] Length = 247 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 2/35 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 L C+R R+RSQSCPFCR SLKRVNSGDLW++TDS Sbjct: 172 LKCYREWRSRSQSCPFCRDSLKRVNSGDLWVFTDS 206 >ref|XP_002269005.2| PREDICTED: uncharacterized protein LOC100244841 [Vitis vinifera] gi|147854404|emb|CAN81290.1| hypothetical protein VITISV_005312 [Vitis vinifera] gi|296084737|emb|CBI25878.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 2/35 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 L C+R R+RSQSCPFCR SLKRVNSGDLW++TDS Sbjct: 167 LKCYREWRSRSQSCPFCRDSLKRVNSGDLWVFTDS 201 >ref|XP_004485751.1| PREDICTED: uncharacterized protein LOC101513299 [Cicer arietinum] Length = 251 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 84 RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 RARSQSCPFCR SLKRVNSGDLWI+TDS Sbjct: 183 RARSQSCPFCRDSLKRVNSGDLWIFTDS 210 >gb|AFK44968.1| unknown [Medicago truncatula] Length = 230 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 84 RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 RARSQSCPFCR SLKRVNSGDLWI+TDS Sbjct: 183 RARSQSCPFCRDSLKRVNSGDLWIFTDS 210 >ref|XP_003637398.1| RING finger protein [Medicago truncatula] gi|355503333|gb|AES84536.1| RING finger protein [Medicago truncatula] Length = 248 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 2/34 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTD 4 L C+R R RSQSCPFCR SLKRVNSGDLW+YTD Sbjct: 173 LKCYREWRTRSQSCPFCRDSLKRVNSGDLWVYTD 206 >ref|XP_006398607.1| hypothetical protein EUTSA_v10014523mg [Eutrema salsugineum] gi|312282839|dbj|BAJ34285.1| unnamed protein product [Thellungiella halophila] gi|557099697|gb|ESQ40060.1| hypothetical protein EUTSA_v10014523mg [Eutrema salsugineum] Length = 242 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = -3 Query: 117 ICINKSLFCFR--RARSQSCPFCRHSLKRVNSGDLWIYT 7 +CIN C+R RARSQSCPFCR SLKRVNSGDLW+YT Sbjct: 165 MCIN----CYRNWRARSQSCPFCRGSLKRVNSGDLWLYT 199 >ref|XP_003593524.1| RING finger protein [Medicago truncatula] gi|124360609|gb|ABN08608.1| Zinc finger, RING-type [Medicago truncatula] gi|355482572|gb|AES63775.1| RING finger protein [Medicago truncatula] Length = 251 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 84 RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 RARSQSCPFCR SLKRVNSGDLWI+TDS Sbjct: 183 RARSQSCPFCRDSLKRVNSGDLWIFTDS 210 >ref|XP_002309135.2| hypothetical protein POPTR_0006s10050g [Populus trichocarpa] gi|550335902|gb|EEE92658.2| hypothetical protein POPTR_0006s10050g [Populus trichocarpa] Length = 246 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYT 7 L C+R RARSQSCPFCR SLKRVNSGDLWIYT Sbjct: 170 LKCYRDWRARSQSCPFCRDSLKRVNSGDLWIYT 202 >gb|EMS55110.1| hypothetical protein TRIUR3_28361 [Triticum urartu] Length = 216 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 105 KSLFCFRRARSQSCPFCRHSLKRVNSGDLWIYTDS 1 K++ RR+RSQSCPFCR SLKRVNS DLWIYTD+ Sbjct: 117 KAICIERRSRSQSCPFCRDSLKRVNSADLWIYTDN 151 >ref|NP_001149292.1| RNA-binding protein [Zea mays] gi|195626094|gb|ACG34877.1| RNA-binding protein [Zea mays] gi|552766323|tpg|DAA41674.2| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Length = 242 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -3 Query: 93 CFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 C+R R+RSQSCPFCR SLKRVNS DLWIYTDS Sbjct: 169 CYREWRSRSQSCPFCRDSLKRVNSADLWIYTDS 201 >ref|XP_006449317.1| hypothetical protein CICLE_v10016413mg [Citrus clementina] gi|557551928|gb|ESR62557.1| hypothetical protein CICLE_v10016413mg [Citrus clementina] Length = 206 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 L C+R R RSQSCPFCR SLKRVNSGDLW+Y DS Sbjct: 131 LKCYREWRTRSQSCPFCRDSLKRVNSGDLWVYMDS 165 >ref|XP_006449316.1| hypothetical protein CICLE_v10016413mg [Citrus clementina] gi|557551927|gb|ESR62556.1| hypothetical protein CICLE_v10016413mg [Citrus clementina] Length = 247 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 L C+R R RSQSCPFCR SLKRVNSGDLW+Y DS Sbjct: 172 LKCYREWRTRSQSCPFCRDSLKRVNSGDLWVYMDS 206 >ref|XP_006449315.1| hypothetical protein CICLE_v10016413mg [Citrus clementina] gi|557551926|gb|ESR62555.1| hypothetical protein CICLE_v10016413mg [Citrus clementina] Length = 167 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 99 LFCFR--RARSQSCPFCRHSLKRVNSGDLWIYTDS 1 L C+R R RSQSCPFCR SLKRVNSGDLW+Y DS Sbjct: 92 LKCYREWRTRSQSCPFCRDSLKRVNSGDLWVYMDS 126 >ref|XP_004500248.1| PREDICTED: uncharacterized protein LOC101492325 isoform X2 [Cicer arietinum] Length = 223 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 2/40 (5%) Frame = -3 Query: 114 CINKSLFCFRR--ARSQSCPFCRHSLKRVNSGDLWIYTDS 1 C L C+R RSQSCPFCR SLKRVNSGDLWIYTD+ Sbjct: 143 CHQMCLKCYRDWCLRSQSCPFCRDSLKRVNSGDLWIYTDT 182