BLASTX nr result
ID: Papaver25_contig00023060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00023060 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007040930.1| Ankyrin repeat family protein [Theobroma cac... 59 9e-07 ref|XP_003612573.1| Ankyrin repeat domain-containing protein [Me... 57 3e-06 ref|XP_004512364.1| PREDICTED: ankyrin-3-like [Cicer arietinum] 57 3e-06 ref|XP_002304390.2| ankyrin repeat family protein [Populus trich... 56 5e-06 gb|EXC35173.1| hypothetical protein L484_022726 [Morus notabilis] 55 8e-06 >ref|XP_007040930.1| Ankyrin repeat family protein [Theobroma cacao] gi|508778175|gb|EOY25431.1| Ankyrin repeat family protein [Theobroma cacao] Length = 171 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 411 EDINDSRFNPPLHYCPGLDFAYEEAEPLRNGNL 313 +DINDSRFNPPLHYCPGL++AYEE + L+ NL Sbjct: 127 DDINDSRFNPPLHYCPGLEWAYEEMKRLQRDNL 159 >ref|XP_003612573.1| Ankyrin repeat domain-containing protein [Medicago truncatula] gi|355513908|gb|AES95531.1| Ankyrin repeat domain-containing protein [Medicago truncatula] Length = 203 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 408 DINDSRFNPPLHYCPGLDFAYEEAEPLRNGNLLSVD 301 DINDSRFNPPLHYCPGL++AYEE + LR L D Sbjct: 161 DINDSRFNPPLHYCPGLEWAYEEMKRLRQEELSPED 196 >ref|XP_004512364.1| PREDICTED: ankyrin-3-like [Cicer arietinum] Length = 172 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 408 DINDSRFNPPLHYCPGLDFAYEEAEPLRNGNL 313 DINDSRFNPPLHYCPGL++AYEE + LR L Sbjct: 130 DINDSRFNPPLHYCPGLEWAYEEMKRLRQEEL 161 >ref|XP_002304390.2| ankyrin repeat family protein [Populus trichocarpa] gi|550342898|gb|EEE79369.2| ankyrin repeat family protein [Populus trichocarpa] Length = 176 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 411 EDINDSRFNPPLHYCPGLDFAYEEAEPLRNGNLLS 307 +DINDSRFNPPLHYCPGL++AYEE + + NL S Sbjct: 133 DDINDSRFNPPLHYCPGLEWAYEEMKRHQRENLSS 167 >gb|EXC35173.1| hypothetical protein L484_022726 [Morus notabilis] Length = 225 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 408 DINDSRFNPPLHYCPGLDFAYEEAEPLRNGN 316 DIND RFNPPLHYCPGL++AYEE E L+ N Sbjct: 183 DINDCRFNPPLHYCPGLEWAYEELERLQQEN 213