BLASTX nr result
ID: Papaver25_contig00022928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00022928 (1080 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836153.1| hypothetical protein AMTR_s00101p00033020 [A... 58 6e-06 ref|XP_003632233.1| PREDICTED: uncharacterized protein LOC100258... 58 8e-06 >ref|XP_006836153.1| hypothetical protein AMTR_s00101p00033020 [Amborella trichopoda] gi|548838653|gb|ERM99006.1| hypothetical protein AMTR_s00101p00033020 [Amborella trichopoda] Length = 481 Score = 58.2 bits (139), Expect = 6e-06 Identities = 34/61 (55%), Positives = 39/61 (63%), Gaps = 7/61 (11%) Frame = +2 Query: 2 GYGSQPSALGSNAMAGYGTQPGMQ----GGYQN-PMGQPNAG-RSQQG-GHMGGVPPYMG 160 GYG Q N M GYG+Q +Q GGYQN MGQP +G R+QQG G MGGV PY+G Sbjct: 421 GYGGQGGMGSGNMMGGYGSQGAVQGVGVGGYQNAQMGQPGSGVRAQQGVGAMGGVTPYIG 480 Query: 161 H 163 H Sbjct: 481 H 481 >ref|XP_003632233.1| PREDICTED: uncharacterized protein LOC100258161 isoform 1 [Vitis vinifera] gi|359479207|ref|XP_003632234.1| PREDICTED: uncharacterized protein LOC100258161 isoform 2 [Vitis vinifera] gi|147853236|emb|CAN80681.1| hypothetical protein VITISV_037734 [Vitis vinifera] Length = 478 Score = 57.8 bits (138), Expect = 8e-06 Identities = 29/55 (52%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +2 Query: 2 GYGSQPSALGSNAMAGYGTQPGMQGGYQNP-MGQPNAGRSQQGGHMGGVPPYMGH 163 G G+ YG+QPGMQGGYQNP MGQ + GR QQGG PYMGH Sbjct: 429 GMQGMQGGYGNQGAGSYGSQPGMQGGYQNPQMGQASGGRPQQGG-----APYMGH 478