BLASTX nr result
ID: Papaver25_contig00022514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00022514 (1013 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24161.1| hypothetical protein MIMGU_mgv1a014413mg [Mimulus... 58 7e-06 >gb|EYU24161.1| hypothetical protein MIMGU_mgv1a014413mg [Mimulus guttatus] Length = 190 Score = 57.8 bits (138), Expect = 7e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -1 Query: 671 GHPLRKDLPPSGYVEVRYDDTEKHVVSGLDPFKMKTSF 558 GHPLRKDLP SGYVEVRYDD EKHVVS +P +M F Sbjct: 140 GHPLRKDLPLSGYVEVRYDDPEKHVVS--EPIEMTQEF 175