BLASTX nr result
ID: Papaver25_contig00021705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00021705 (1109 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB89650.1| hypothetical protein L484_018753 [Morus notabilis] 60 2e-06 >gb|EXB89650.1| hypothetical protein L484_018753 [Morus notabilis] Length = 204 Score = 59.7 bits (143), Expect = 2e-06 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 11/151 (7%) Frame = -2 Query: 853 LKEYLPDQEKIGRAITVVTHPAT---KELIKFFALP-PGGAQAYNIMAAVLKNPPSTSSH 686 L +Y P E + + VT+ A +E +KF +P PGGA ++I A+ ++ PS + Sbjct: 54 LSQYGPSGETMSKIPPFVTNLAVYSAEEALKFIPVPLPGGASGFSICKAIKRSWPSDA-- 111 Query: 685 TCLYENNKYKQVMEELMVLRDEKDRMQAEIEQIKNEIE-------YPKRLNSTSPARLRS 527 NK K ++ L+ E R+ E+ + KN IE Y S S Sbjct: 112 ------NKSKGGGVDVKALQAEVKRLNKELGECKNWIEQMEMNKKYCSDFESAKTPNSDS 165 Query: 526 SSTVEQKPEDVISLFMMKGFTVLDYRYDQVV 434 +S V +KPEDVI +FMMK F D +V Sbjct: 166 NSVVNRKPEDVIRVFMMKEFIGRQLLDDMIV 196