BLASTX nr result
ID: Papaver25_contig00021344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00021344 (587 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004290430.1| hypothetical protein Metbo_1215 [Methanobact... 60 6e-07 >ref|YP_004290430.1| hypothetical protein Metbo_1215 [Methanobacterium sp. AL-21] gi|503410148|ref|WP_013644809.1| hypothetical protein [Methanobacterium sp. AL-21] gi|325330396|gb|ADZ09458.1| hypothetical protein Metbo_1215 [Methanobacterium sp. AL-21] Length = 330 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/85 (34%), Positives = 50/85 (58%) Frame = -1 Query: 584 LESEIRSLNSVKNKLLTETQFLNKEKMELRRDFEFLNQEKTKLGMDVVLLKKGKSEVETD 405 LE ++ + + KNKL + + L K+K +L E L ++K KL + L+K K+++ Sbjct: 44 LEKQLETSKNDKNKLNNQIETLQKDKNKLNNQIETLQKDKNKLNNQIETLQKDKNKLNNQ 103 Query: 404 LEFLQDEKNKLHGDIHSLNKEKDKL 330 +E LQ +KNKL+ + +L K+K L Sbjct: 104 IETLQKDKNKLNNQMQTLQKDKQAL 128