BLASTX nr result
ID: Papaver25_contig00021223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00021223 (673 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138904.1| PREDICTED: basic leucine zipper and W2 domai... 57 4e-06 >ref|XP_004138904.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Cucumis sativus] gi|449477782|ref|XP_004155121.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Cucumis sativus] Length = 411 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 311 TKEGMLDLVDYNAKKMFDVKLKDMKSALTTQIA 213 TKEG++ LV+YNAKKMFDVKL +MKSALTTQIA Sbjct: 233 TKEGLVPLVEYNAKKMFDVKLSEMKSALTTQIA 265