BLASTX nr result
ID: Papaver25_contig00020802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00020802 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006407281.1| hypothetical protein EUTSA_v10021431mg [Eutr... 55 1e-05 >ref|XP_006407281.1| hypothetical protein EUTSA_v10021431mg [Eutrema salsugineum] gi|557108427|gb|ESQ48734.1| hypothetical protein EUTSA_v10021431mg [Eutrema salsugineum] Length = 238 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 379 NNVSEQSDEMFDDLFDKYGKVVYSSGDQKPP 471 +NVSE SDEMFDDLF+KYGKVVY S DQK P Sbjct: 80 SNVSEDSDEMFDDLFNKYGKVVYRSDDQKSP 110