BLASTX nr result
ID: Papaver25_contig00020539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00020539 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002455129.1| hypothetical protein SORBIDRAFT_03g004820 [S... 59 9e-07 ref|XP_007020841.1| Uncharacterized protein TCM_030890 [Theobrom... 57 3e-06 ref|XP_002455128.1| hypothetical protein SORBIDRAFT_03g004815 [S... 56 5e-06 >ref|XP_002455129.1| hypothetical protein SORBIDRAFT_03g004820 [Sorghum bicolor] gi|241927104|gb|EES00249.1| hypothetical protein SORBIDRAFT_03g004820 [Sorghum bicolor] Length = 339 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%) Frame = -2 Query: 278 SLTYCVECDDEFFKIRIYFHGRGIEKIVISIQITRLDFSLMEWKVVNTLGDHVLFIGQNT 99 ++TY +E D + F + I+F G +E+I + ++DFS EW V +GD +G ++ Sbjct: 217 TMTYLLESDQDLFLVCIFFLGCSLERIE-EVGAYKMDFSRKEWCKVTDIGDRAFLLGAHS 275 Query: 98 -RVCCSAAELGLAKGCLYYTL 39 CSA E GL +GC+Y+ L Sbjct: 276 FAASCSAEEHGLKRGCVYFAL 296 >ref|XP_007020841.1| Uncharacterized protein TCM_030890 [Theobroma cacao] gi|508720469|gb|EOY12366.1| Uncharacterized protein TCM_030890 [Theobroma cacao] Length = 542 Score = 57.0 bits (136), Expect = 3e-06 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 2/91 (2%) Frame = -2 Query: 269 YCVECDDEFFKIRIYFHGRGIEKIVISIQITRLDFSLMEWKVVNTLGDHVLFIGQNT--R 96 Y VE E I + + G + V++I+I+RLDFS MEW V + D FI + Sbjct: 236 YLVESCGELCVIEVTWGGVNACQ-VLNIEISRLDFSTMEWSQVRSAKDRAFFISNFSVYA 294 Query: 95 VCCSAAELGLAKGCLYYTLPEDQRLYKFEVE 3 + C A E G+ G +YYT+ D+ LY F +E Sbjct: 295 ISCPANESGIEGGFVYYTVGTDRCLYSFNIE 325 >ref|XP_002455128.1| hypothetical protein SORBIDRAFT_03g004815 [Sorghum bicolor] gi|241927103|gb|EES00248.1| hypothetical protein SORBIDRAFT_03g004815 [Sorghum bicolor] Length = 296 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%) Frame = -2 Query: 305 FRGARETSWSLTYCVECDDEFFKIRIYFHGRGIEKIVISIQITRLDFSLMEWKVVNTLGD 126 F +R+ L++ E E F + ++F G +E V + ++DFS EW V +GD Sbjct: 169 FTKSRDVLGVLSFAQESSQELFLVCLFFLGCSLE-CVEEVSAYKMDFSKKEWCKVTDIGD 227 Query: 125 HVLFIGQNT-RVCCSAAELGLAKGCLYYTL 39 +G ++ CSAAE GL +GC+Y+ L Sbjct: 228 RAFLLGAHSFAASCSAAEHGLKRGCVYFAL 257