BLASTX nr result
ID: Papaver25_contig00020530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00020530 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007046362.1| TRNA arginine adenosine deaminase, putative ... 59 9e-07 ref|XP_007046361.1| TRNA arginine adenosine deaminase, putative ... 59 9e-07 ref|XP_003516872.2| PREDICTED: tRNA(adenine(34)) deaminase, chlo... 55 1e-05 >ref|XP_007046362.1| TRNA arginine adenosine deaminase, putative isoform 2 [Theobroma cacao] gi|508710297|gb|EOY02194.1| TRNA arginine adenosine deaminase, putative isoform 2 [Theobroma cacao] Length = 1201 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 450 EKKSDSPAPPPFCLPISGQPSKIITKMHDVFHIMFCL 340 EK ++ P P P CLPI+ PSKIITKMHD+FH+MFCL Sbjct: 1166 EKNAERP-PSPSCLPITSHPSKIITKMHDIFHVMFCL 1201 >ref|XP_007046361.1| TRNA arginine adenosine deaminase, putative isoform 1 [Theobroma cacao] gi|508710296|gb|EOY02193.1| TRNA arginine adenosine deaminase, putative isoform 1 [Theobroma cacao] Length = 1317 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 450 EKKSDSPAPPPFCLPISGQPSKIITKMHDVFHIMFCL 340 EK ++ P P P CLPI+ PSKIITKMHD+FH+MFCL Sbjct: 1282 EKNAERP-PSPSCLPITSHPSKIITKMHDIFHVMFCL 1317 >ref|XP_003516872.2| PREDICTED: tRNA(adenine(34)) deaminase, chloroplastic-like isoform X1 [Glycine max] gi|571434749|ref|XP_006573284.1| PREDICTED: tRNA(adenine(34)) deaminase, chloroplastic-like isoform X2 [Glycine max] Length = 1313 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = -2 Query: 450 EKKSDSPAPPPFCLPISGQPSKIITKMHDVFHIMFCL 340 +KK + P+ P CLP++ PSK++ K+HDVFHIMFCL Sbjct: 1277 KKKKEEPSNDPSCLPVTHHPSKLLNKIHDVFHIMFCL 1313