BLASTX nr result
ID: Papaver25_contig00020401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00020401 (742 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC32787.1| hypothetical protein L484_019901 [Morus notabilis] 58 4e-06 >gb|EXC32787.1| hypothetical protein L484_019901 [Morus notabilis] Length = 113 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 393 RVRVSYDPSSYLKNFDQGCPLNEPDCYSRSFSARYAHPSRI 515 R++ SYDP++Y KNFDQG EPD SRSFSAR+A PSRI Sbjct: 64 RLQPSYDPTTYSKNFDQGMGWEEPDYLSRSFSARFADPSRI 104