BLASTX nr result
ID: Papaver25_contig00020362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00020362 (1009 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004296242.1| PREDICTED: uncharacterized protein LOC101312... 66 2e-08 ref|NP_974914.2| PAS domain-containing protein tyrosine kinase [... 66 2e-08 ref|XP_002863985.1| kinase family protein [Arabidopsis lyrata su... 66 2e-08 ref|XP_003534813.2| PREDICTED: probable serine/threonine-protein... 66 3e-08 ref|XP_007147367.1| hypothetical protein PHAVU_006G118300g [Phas... 66 3e-08 ref|XP_006297037.1| hypothetical protein CARUB_v10013028mg [Caps... 66 3e-08 ref|NP_187314.1| PAS domain-containing tyrosine kinase-like prot... 66 3e-08 emb|CAN70981.1| hypothetical protein VITISV_034769 [Vitis vinifera] 66 3e-08 gb|ABK06414.1| flag-tagged protein kinase domain of putative mit... 66 3e-08 gb|EXC24964.1| Serine/threonine-protein kinase [Morus notabilis] 65 4e-08 ref|XP_006419378.1| hypothetical protein CICLE_v10004362mg [Citr... 65 4e-08 ref|XP_006419377.1| hypothetical protein CICLE_v10004362mg [Citr... 65 4e-08 ref|XP_006419376.1| hypothetical protein CICLE_v10004362mg [Citr... 65 4e-08 ref|XP_006395059.1| hypothetical protein EUTSA_v10003711mg [Eutr... 65 4e-08 ref|XP_002312329.2| hypothetical protein POPTR_0008s10460g [Popu... 65 4e-08 ref|XP_002314950.2| kinase family protein [Populus trichocarpa] ... 65 4e-08 ref|XP_006841450.1| hypothetical protein AMTR_s00003p00081550 [A... 65 4e-08 ref|XP_007035811.1| PAS domain-containing protein tyrosine kinas... 65 4e-08 ref|XP_006280141.1| hypothetical protein CARUB_v10026037mg [Caps... 65 4e-08 ref|XP_006280140.1| hypothetical protein CARUB_v10026037mg [Caps... 65 4e-08 >ref|XP_004296242.1| PREDICTED: uncharacterized protein LOC101312816 [Fragaria vesca subsp. vesca] Length = 732 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRL+HPN+LLFMGAVTSPQHLCIVTE+LP Sbjct: 496 FRQEVSLMKRLQHPNILLFMGAVTSPQHLCIVTEFLP 532 >ref|NP_974914.2| PAS domain-containing protein tyrosine kinase [Arabidopsis thaliana] gi|332008432|gb|AED95815.1| PAS domain-containing protein tyrosine kinase [Arabidopsis thaliana] Length = 831 Score = 66.2 bits (160), Expect = 2e-08 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLPWF 192 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP F Sbjct: 530 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRF 568 >ref|XP_002863985.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297309820|gb|EFH40244.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 856 Score = 66.2 bits (160), Expect = 2e-08 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLPWF 192 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP F Sbjct: 532 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRF 570 >ref|XP_003534813.2| PREDICTED: probable serine/threonine-protein kinase DDB_G0272254-like [Glycine max] Length = 725 Score = 65.9 bits (159), Expect = 3e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V +MKRLRHPN++LFMGAVTSPQHLCIVTE+LP Sbjct: 489 FKQEVSVMKRLRHPNIILFMGAVTSPQHLCIVTEFLP 525 >ref|XP_007147367.1| hypothetical protein PHAVU_006G118300g [Phaseolus vulgaris] gi|561020590|gb|ESW19361.1| hypothetical protein PHAVU_006G118300g [Phaseolus vulgaris] Length = 722 Score = 65.9 bits (159), Expect = 3e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V +MKRLRHPN++LFMGAVTSPQHLCIVTE+LP Sbjct: 484 FRQEVSVMKRLRHPNIILFMGAVTSPQHLCIVTEFLP 520 >ref|XP_006297037.1| hypothetical protein CARUB_v10013028mg [Capsella rubella] gi|482565746|gb|EOA29935.1| hypothetical protein CARUB_v10013028mg [Capsella rubella] Length = 769 Score = 65.9 bits (159), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +VLLMKRLRHPNVLLFMGAVTSPQ LCIV+E+LP Sbjct: 532 FKQEVLLMKRLRHPNVLLFMGAVTSPQRLCIVSEFLP 568 >ref|NP_187314.1| PAS domain-containing tyrosine kinase-like protein [Arabidopsis thaliana] gi|12322680|gb|AAG51332.1|AC020580_12 protein kinase, putative; 19229-23534 [Arabidopsis thaliana] gi|20258844|gb|AAM13904.1| putative protein kinase [Arabidopsis thaliana] gi|21689823|gb|AAM67555.1| putative protein kinase [Arabidopsis thaliana] gi|110741529|dbj|BAE98714.1| putative protein kinase [Arabidopsis thaliana] gi|332640902|gb|AEE74423.1| PAS domain-containing tyrosine kinase-like protein [Arabidopsis thaliana] Length = 773 Score = 65.9 bits (159), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +VLLMKRLRHPNVLLFMGAVTSPQ LCIV+E+LP Sbjct: 536 FKQEVLLMKRLRHPNVLLFMGAVTSPQRLCIVSEFLP 572 >emb|CAN70981.1| hypothetical protein VITISV_034769 [Vitis vinifera] Length = 760 Score = 65.9 bits (159), Expect = 3e-08 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLPWFIL 186 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP +L Sbjct: 512 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLPRCVL 552 >gb|ABK06414.1| flag-tagged protein kinase domain of putative mitogen-activated protein kinase kinase kinase [synthetic construct] Length = 301 Score = 65.9 bits (159), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +VLLMKRLRHPNVLLFMGAVTSPQ LCIV+E+LP Sbjct: 53 FKQEVLLMKRLRHPNVLLFMGAVTSPQRLCIVSEFLP 89 >gb|EXC24964.1| Serine/threonine-protein kinase [Morus notabilis] Length = 760 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 524 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 560 >ref|XP_006419378.1| hypothetical protein CICLE_v10004362mg [Citrus clementina] gi|557521251|gb|ESR32618.1| hypothetical protein CICLE_v10004362mg [Citrus clementina] Length = 783 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 550 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 586 >ref|XP_006419377.1| hypothetical protein CICLE_v10004362mg [Citrus clementina] gi|568871321|ref|XP_006488838.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0282963-like [Citrus sinensis] gi|557521250|gb|ESR32617.1| hypothetical protein CICLE_v10004362mg [Citrus clementina] Length = 782 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 549 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 585 >ref|XP_006419376.1| hypothetical protein CICLE_v10004362mg [Citrus clementina] gi|557521249|gb|ESR32616.1| hypothetical protein CICLE_v10004362mg [Citrus clementina] Length = 770 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 549 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 585 >ref|XP_006395059.1| hypothetical protein EUTSA_v10003711mg [Eutrema salsugineum] gi|557091698|gb|ESQ32345.1| hypothetical protein EUTSA_v10003711mg [Eutrema salsugineum] Length = 734 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 497 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 533 >ref|XP_002312329.2| hypothetical protein POPTR_0008s10460g [Populus trichocarpa] gi|550332787|gb|EEE89696.2| hypothetical protein POPTR_0008s10460g [Populus trichocarpa] Length = 645 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 409 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 445 >ref|XP_002314950.2| kinase family protein [Populus trichocarpa] gi|550329883|gb|EEF01121.2| kinase family protein [Populus trichocarpa] Length = 781 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 545 FKQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 581 >ref|XP_006841450.1| hypothetical protein AMTR_s00003p00081550 [Amborella trichopoda] gi|548843471|gb|ERN03125.1| hypothetical protein AMTR_s00003p00081550 [Amborella trichopoda] Length = 653 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 414 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 450 >ref|XP_007035811.1| PAS domain-containing protein tyrosine kinase family protein [Theobroma cacao] gi|508714840|gb|EOY06737.1| PAS domain-containing protein tyrosine kinase family protein [Theobroma cacao] Length = 761 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 525 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 561 >ref|XP_006280141.1| hypothetical protein CARUB_v10026037mg [Capsella rubella] gi|482548845|gb|EOA13039.1| hypothetical protein CARUB_v10026037mg [Capsella rubella] Length = 661 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 424 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 460 >ref|XP_006280140.1| hypothetical protein CARUB_v10026037mg [Capsella rubella] gi|482548844|gb|EOA13038.1| hypothetical protein CARUB_v10026037mg [Capsella rubella] Length = 642 Score = 65.1 bits (157), Expect = 4e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 308 FCTKVLLMKRLRHPNVLLFMGAVTSPQHLCIVTEYLP 198 F +V LMKRLRHPNVLLFMGAVTSPQ LCIVTE+LP Sbjct: 405 FRQEVSLMKRLRHPNVLLFMGAVTSPQRLCIVTEFLP 441