BLASTX nr result
ID: Papaver25_contig00020308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00020308 (1005 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA39417.1| TPA: hypothetical protein ZEAMMB73_201442 [Zea m... 57 9e-06 >tpg|DAA39417.1| TPA: hypothetical protein ZEAMMB73_201442 [Zea mays] Length = 732 Score = 57.4 bits (137), Expect = 9e-06 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Frame = +2 Query: 434 HIKLGFHHVLGTSNVDEGLCGHLTKCDCCSGDKSQ-WKYQ*AXXXXXXXXXXCPSRFSIL 610 H K GF+ VLG+SNVDEGL G+LTK DC S D + ++S L Sbjct: 504 HNKSGFYLVLGSSNVDEGLRGYLTKYDCSSADVNPIGSVSKQDLRAFLRWAAIHLKYSSL 563 Query: 611 EKTEASPPIDELEPM*SNY 667 + EA+PP ELEP+ +NY Sbjct: 564 AEVEAAPPTAELEPIRANY 582