BLASTX nr result
ID: Papaver25_contig00019712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00019712 (557 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200472.1| hypothetical protein PRUPE_ppa012853mg [Prun... 57 4e-06 ref|XP_007225841.1| hypothetical protein PRUPE_ppa011659mg [Prun... 55 9e-06 >ref|XP_007200472.1| hypothetical protein PRUPE_ppa012853mg [Prunus persica] gi|462395872|gb|EMJ01671.1| hypothetical protein PRUPE_ppa012853mg [Prunus persica] Length = 152 Score = 56.6 bits (135), Expect = 4e-06 Identities = 37/73 (50%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = -1 Query: 224 CSSLSLRKNKQTEGWELSGT*LGNLMTIVSNPVNSKSDTIF*RERRIYKDRRYSQFVSNA 45 C + NK+ ELS L NLMTIV+NP K F ++ YKD RYSQ VSNA Sbjct: 45 CKKADVDMNKRAG--ELSAAELDNLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNA 102 Query: 44 HDMKL-DDLKCLK 9 DMKL DDL+ LK Sbjct: 103 LDMKLRDDLERLK 115 >ref|XP_007225841.1| hypothetical protein PRUPE_ppa011659mg [Prunus persica] gi|462422777|gb|EMJ27040.1| hypothetical protein PRUPE_ppa011659mg [Prunus persica] Length = 202 Score = 55.5 bits (132), Expect = 9e-06 Identities = 36/73 (49%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = -1 Query: 224 CSSLSLRKNKQTEGWELSGT*LGNLMTIVSNPVNSKSDTIF*RERRIYKDRRYSQFVSNA 45 C + NK+ ELS L NLMTIV+NP K F ++ YKD +YSQ VSNA Sbjct: 95 CKKADVDMNKRAG--ELSAAELDNLMTIVANPRQFKIPDWFLNRKKDYKDGKYSQVVSNA 152 Query: 44 HDMKL-DDLKCLK 9 DMKL DDL+ LK Sbjct: 153 LDMKLRDDLERLK 165