BLASTX nr result
ID: Papaver25_contig00019435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00019435 (567 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135332.1| PREDICTED: uncharacterized protein ZK637.2-l... 65 1e-08 ref|XP_006410302.1| hypothetical protein EUTSA_v10017374mg [Eutr... 65 2e-08 ref|XP_007033729.1| Uncharacterized protein isoform 2 [Theobroma... 65 2e-08 ref|XP_007033728.1| Uncharacterized protein isoform 1 [Theobroma... 65 2e-08 ref|XP_002881193.1| hypothetical protein ARALYDRAFT_482095 [Arab... 65 2e-08 ref|XP_006376445.1| hypothetical protein POPTR_0013s13110g [Popu... 65 2e-08 ref|NP_565729.1| uncharacterized protein [Arabidopsis thaliana] ... 65 2e-08 gb|EXB88319.1| hypothetical protein L484_020387 [Morus notabilis] 64 4e-08 ref|XP_006295163.1| hypothetical protein CARUB_v10024240mg [Caps... 64 4e-08 ref|XP_007225986.1| hypothetical protein PRUPE_ppa012819mg [Prun... 64 4e-08 ref|XP_003598260.1| Protein FAM136A [Medicago truncatula] gi|355... 64 4e-08 ref|XP_002269805.1| PREDICTED: protein FAM136A [Vitis vinifera] ... 64 4e-08 gb|AFK37463.1| unknown [Lotus japonicus] 63 5e-08 ref|XP_006442767.1| hypothetical protein CICLE_v10022699mg [Citr... 62 8e-08 gb|AAD30622.1|AC007153_14 Hypothetical Protein [Arabidopsis thal... 62 8e-08 ref|XP_004499670.1| PREDICTED: protein FAM136A-like [Cicer ariet... 62 1e-07 ref|XP_004294626.1| PREDICTED: uncharacterized protein ZK637.2-l... 62 1e-07 ref|NP_172064.2| uncharacterized protein [Arabidopsis thaliana] ... 62 1e-07 ref|XP_002889561.1| hypothetical protein ARALYDRAFT_470580 [Arab... 62 1e-07 ref|XP_002524870.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 >ref|XP_004135332.1| PREDICTED: uncharacterized protein ZK637.2-like [Cucumis sativus] gi|449521848|ref|XP_004167941.1| PREDICTED: uncharacterized protein ZK637.2-like [Cucumis sativus] Length = 148 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRR+ EEISNCVENCS+ Sbjct: 39 NFSLQQAYFKCAYECFDRRRRQEEISNCVENCSV 72 >ref|XP_006410302.1| hypothetical protein EUTSA_v10017374mg [Eutrema salsugineum] gi|557111471|gb|ESQ51755.1| hypothetical protein EUTSA_v10017374mg [Eutrema salsugineum] Length = 149 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRRK EEISNCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRRRKQEEISNCVEHCSV 72 >ref|XP_007033729.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508712758|gb|EOY04655.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 149 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRRK EEISNCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRRRKQEEISNCVEHCSV 72 >ref|XP_007033728.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508712757|gb|EOY04654.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 153 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRRK EEISNCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRRRKQEEISNCVEHCSV 72 >ref|XP_002881193.1| hypothetical protein ARALYDRAFT_482095 [Arabidopsis lyrata subsp. lyrata] gi|297327032|gb|EFH57452.1| hypothetical protein ARALYDRAFT_482095 [Arabidopsis lyrata subsp. lyrata] Length = 149 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRRK EEISNCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRRRKQEEISNCVEHCSV 72 >ref|XP_006376445.1| hypothetical protein POPTR_0013s13110g [Populus trichocarpa] gi|550325721|gb|ERP54242.1| hypothetical protein POPTR_0013s13110g [Populus trichocarpa] Length = 153 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRRK EEISNCVE+CS+ Sbjct: 40 NFTLQQAYFKCAYECFDRRRKQEEISNCVEHCSV 73 >ref|NP_565729.1| uncharacterized protein [Arabidopsis thaliana] gi|20197845|gb|AAM15277.1| expressed protein [Arabidopsis thaliana] gi|20198066|gb|AAM15381.1| expressed protein [Arabidopsis thaliana] gi|21554341|gb|AAM63448.1| unknown [Arabidopsis thaliana] gi|330253483|gb|AEC08577.1| uncharacterized protein AT2G31725 [Arabidopsis thaliana] Length = 149 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRRK EEISNCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRRRKQEEISNCVEHCSV 72 >gb|EXB88319.1| hypothetical protein L484_020387 [Morus notabilis] Length = 149 Score = 63.5 bits (153), Expect = 4e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRRK EEISNCVE CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRRRKQEEISNCVEYCSV 72 >ref|XP_006295163.1| hypothetical protein CARUB_v10024240mg [Capsella rubella] gi|482563871|gb|EOA28061.1| hypothetical protein CARUB_v10024240mg [Capsella rubella] Length = 154 Score = 63.5 bits (153), Expect = 4e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRRK EEISNCVE CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRRRKQEEISNCVEYCSV 72 >ref|XP_007225986.1| hypothetical protein PRUPE_ppa012819mg [Prunus persica] gi|462422922|gb|EMJ27185.1| hypothetical protein PRUPE_ppa012819mg [Prunus persica] Length = 153 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRR +EISNCVENCS+ Sbjct: 39 NFTLQQAYFKCAYECFDRRRSQQEISNCVENCSV 72 >ref|XP_003598260.1| Protein FAM136A [Medicago truncatula] gi|355487308|gb|AES68511.1| Protein FAM136A [Medicago truncatula] Length = 152 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSILL 558 N LQ+ YFKCAYECFDR RK EEISNCVENCSI L Sbjct: 39 NYTLQKAYFKCAYECFDRSRKQEEISNCVENCSIPL 74 >ref|XP_002269805.1| PREDICTED: protein FAM136A [Vitis vinifera] gi|147838243|emb|CAN73933.1| hypothetical protein VITISV_042801 [Vitis vinifera] gi|296083351|emb|CBI22987.3| unnamed protein product [Vitis vinifera] Length = 149 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDR+RK EEISNCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRKRKQEEISNCVEHCSV 72 >gb|AFK37463.1| unknown [Lotus japonicus] Length = 150 Score = 63.2 bits (152), Expect = 5e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSILL 558 N LQ+ YFKCAYECFDRRR+ EEI+NCVENCS+ L Sbjct: 39 NYTLQKAYFKCAYECFDRRRRQEEITNCVENCSVPL 74 >ref|XP_006442767.1| hypothetical protein CICLE_v10022699mg [Citrus clementina] gi|568882445|ref|XP_006494041.1| PREDICTED: uncharacterized protein LOC102618894 [Citrus sinensis] gi|557545029|gb|ESR56007.1| hypothetical protein CICLE_v10022699mg [Citrus clementina] Length = 149 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDR RK EEISNCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRTRKQEEISNCVEHCSV 72 >gb|AAD30622.1|AC007153_14 Hypothetical Protein [Arabidopsis thaliana] Length = 161 Score = 62.4 bits (150), Expect = 8e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 454 DLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 D LQQ YFKCAYECFDR RK EEI+NCVE+CS+ Sbjct: 52 DQLQQAYFKCAYECFDRNRKQEEIANCVEHCSV 84 >ref|XP_004499670.1| PREDICTED: protein FAM136A-like [Cicer arietinum] Length = 152 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSILL 558 N LQ+ YFKCAYECFDR R+ EEISNCVENCS+ L Sbjct: 39 NYTLQKAYFKCAYECFDRSRRQEEISNCVENCSVPL 74 >ref|XP_004294626.1| PREDICTED: uncharacterized protein ZK637.2-like [Fragaria vesca subsp. vesca] Length = 143 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDRRR +EI NCVENCS+ Sbjct: 33 NFTLQQAYFKCAYECFDRRRSQQEIGNCVENCSV 66 >ref|NP_172064.2| uncharacterized protein [Arabidopsis thaliana] gi|60547533|gb|AAX23730.1| hypothetical protein At1g05730 [Arabidopsis thaliana] gi|91805747|gb|ABE65602.1| unknown [Arabidopsis thaliana] gi|332189764|gb|AEE27885.1| uncharacterized protein AT1G05730 [Arabidopsis thaliana] Length = 149 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDR RK EEI+NCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRNRKQEEIANCVEHCSV 72 >ref|XP_002889561.1| hypothetical protein ARALYDRAFT_470580 [Arabidopsis lyrata subsp. lyrata] gi|297335403|gb|EFH65820.1| hypothetical protein ARALYDRAFT_470580 [Arabidopsis lyrata subsp. lyrata] Length = 149 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDR RK EEI+NCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRNRKQEEIANCVEHCSV 72 >ref|XP_002524870.1| conserved hypothetical protein [Ricinus communis] gi|223535833|gb|EEF37494.1| conserved hypothetical protein [Ricinus communis] Length = 149 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 451 NDLLQQGYFKCAYECFDRRRKFEEISNCVENCSI 552 N LQQ YFKCAYECFDR+RK EEI NCVE+CS+ Sbjct: 39 NFTLQQAYFKCAYECFDRQRKQEEIGNCVEHCSV 72