BLASTX nr result
ID: Papaver25_contig00018014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00018014 (668 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034406.1| Glutathione-disulfide reductase isoform 1 [T... 77 4e-12 ref|XP_002299276.2| glutathione-disulfide reductase family prote... 75 2e-11 gb|ABW96363.1| glutathione reductase [Ipomoea batatas] 74 3e-11 ref|XP_002303826.1| glutathione-disulfide reductase family prote... 74 3e-11 ref|XP_007222141.1| hypothetical protein PRUPE_ppa004673mg [Prun... 74 4e-11 dbj|BAA11214.1| cytosolic glutathione reductase [Oryza sativa Ja... 73 9e-11 ref|NP_001048485.1| Os02g0813500 [Oryza sativa Japonica Group] g... 73 9e-11 ref|XP_004296631.1| PREDICTED: glutathione reductase, cytosolic-... 73 9e-11 gb|EAY87985.1| hypothetical protein OsI_09408 [Oryza sativa Indi... 73 9e-11 gb|ABB89042.1| glutathione reductase [Vigna unguiculata] 73 9e-11 ref|XP_006648092.1| PREDICTED: glutathione reductase, cytosolic-... 72 1e-10 ref|XP_002518118.1| glutathione reductase, putative [Ricinus com... 72 2e-10 ref|XP_002285672.1| PREDICTED: glutathione reductase, cytosolic ... 72 2e-10 emb|CAN65542.1| hypothetical protein VITISV_026403 [Vitis vinifera] 72 2e-10 gb|AHG97672.1| glutathione reductase [Boehmeria nivea] 72 2e-10 ref|XP_004134003.1| PREDICTED: glutathione reductase, cytosolic-... 71 3e-10 gb|ADM96038.1| glutathione reductase [Cucumis sativus] 71 3e-10 gb|AGY14485.1| glutathione reductase, partial [Cicer arietinum] 71 4e-10 ref|XP_004954330.1| PREDICTED: glutathione reductase, cytosolic-... 71 4e-10 ref|XP_004514690.1| PREDICTED: glutathione reductase, cytosolic-... 71 4e-10 >ref|XP_007034406.1| Glutathione-disulfide reductase isoform 1 [Theobroma cacao] gi|590656908|ref|XP_007034407.1| Glutathione-disulfide reductase isoform 1 [Theobroma cacao] gi|508713435|gb|EOY05332.1| Glutathione-disulfide reductase isoform 1 [Theobroma cacao] gi|508713436|gb|EOY05333.1| Glutathione-disulfide reductase isoform 1 [Theobroma cacao] Length = 496 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMRSVSRRI GGKPK +L Sbjct: 453 LKCGATKAQFDSTVGIHPSAAEEFVTMRSVSRRITAGGKPKTNL 496 >ref|XP_002299276.2| glutathione-disulfide reductase family protein [Populus trichocarpa] gi|550347245|gb|EEE84081.2| glutathione-disulfide reductase family protein [Populus trichocarpa] Length = 499 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPK 545 LKCGATK+ FDSTVGIHPSAAEEFVTMRSV+RR+ GGKPK Sbjct: 455 LKCGATKQQFDSTVGIHPSAAEEFVTMRSVTRRVTAGGKPK 495 >gb|ABW96363.1| glutathione reductase [Ipomoea batatas] Length = 494 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMRSV+R +PP KPK +L Sbjct: 451 LKCGATKAQFDSTVGIHPSAAEEFVTMRSVTRVVPPASKPKTNL 494 >ref|XP_002303826.1| glutathione-disulfide reductase family protein [Populus trichocarpa] gi|118488346|gb|ABK95991.1| unknown [Populus trichocarpa] gi|222841258|gb|EEE78805.1| glutathione-disulfide reductase family protein [Populus trichocarpa] Length = 498 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK+ FDSTVGIHPSAAEEFVTMRSV+RR+ GKPK +L Sbjct: 455 LKCGATKQQFDSTVGIHPSAAEEFVTMRSVARRVTASGKPKTNL 498 >ref|XP_007222141.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|596129772|ref|XP_007222142.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|462419077|gb|EMJ23340.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|462419078|gb|EMJ23341.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] Length = 496 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMRSV+RRI G KPK +L Sbjct: 453 LKCGATKAQFDSTVGIHPSAAEEFVTMRSVTRRIAAGSKPKTNL 496 >dbj|BAA11214.1| cytosolic glutathione reductase [Oryza sativa Japonica Group] Length = 496 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMR+++RR+ P KPK +L Sbjct: 453 LKCGATKATFDSTVGIHPSAAEEFVTMRTLTRRVSPSSKPKTNL 496 >ref|NP_001048485.1| Os02g0813500 [Oryza sativa Japonica Group] gi|19860133|sp|P48642.2|GSHRC_ORYSJ RecName: Full=Glutathione reductase, cytosolic; Short=GR; Short=GRase gi|4106694|dbj|BAA36283.1| cytosolic glutathione reductase [Oryza sativa Japonica Group] gi|4153883|dbj|BAA37092.1| cytosolic glutathione reductase [Oryza sativa Japonica Group] gi|47847860|dbj|BAD21653.1| glutathione reductase [Oryza sativa Japonica Group] gi|47848540|dbj|BAD22392.1| glutathione reductase [Oryza sativa Japonica Group] gi|113538016|dbj|BAF10399.1| Os02g0813500 [Oryza sativa Japonica Group] gi|125584119|gb|EAZ25050.1| hypothetical protein OsJ_08842 [Oryza sativa Japonica Group] Length = 496 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMR+++RR+ P KPK +L Sbjct: 453 LKCGATKATFDSTVGIHPSAAEEFVTMRTLTRRVSPSSKPKTNL 496 >ref|XP_004296631.1| PREDICTED: glutathione reductase, cytosolic-like [Fragaria vesca subsp. vesca] gi|400234892|gb|AFP74110.1| glutathione reductase [Fragaria x ananassa] Length = 496 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMRSV+RR+ GKPK L Sbjct: 453 LKCGATKAQFDSTVGIHPSAAEEFVTMRSVTRRVSASGKPKTTL 496 >gb|EAY87985.1| hypothetical protein OsI_09408 [Oryza sativa Indica Group] Length = 553 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMR+++RR+ P KPK +L Sbjct: 510 LKCGATKATFDSTVGIHPSAAEEFVTMRTLTRRVSPSSKPKTNL 553 >gb|ABB89042.1| glutathione reductase [Vigna unguiculata] Length = 499 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK+ FDSTVGIHPSAAEEFVTMR+V+RR+ GKPK +L Sbjct: 456 LKCGATKEQFDSTVGIHPSAAEEFVTMRTVTRRVTGSGKPKTNL 499 >ref|XP_006648092.1| PREDICTED: glutathione reductase, cytosolic-like [Oryza brachyantha] Length = 494 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMR+++RR+ P KPK L Sbjct: 451 LKCGATKAAFDSTVGIHPSAAEEFVTMRTLTRRVSPASKPKTSL 494 >ref|XP_002518118.1| glutathione reductase, putative [Ricinus communis] gi|223542714|gb|EEF44251.1| glutathione reductase, putative [Ricinus communis] Length = 496 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMRS++RR+ G KPK +L Sbjct: 453 LKCGATKAQFDSTVGIHPSAAEEFVTMRSLTRRVNAGNKPKTNL 496 >ref|XP_002285672.1| PREDICTED: glutathione reductase, cytosolic [Vitis vinifera] gi|297741929|emb|CBI33364.3| unnamed protein product [Vitis vinifera] Length = 496 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FD TVGIHPSAAEEFVTMRSV+RRI G KPK +L Sbjct: 453 LKCGATKAQFDCTVGIHPSAAEEFVTMRSVTRRIAAGNKPKTNL 496 >emb|CAN65542.1| hypothetical protein VITISV_026403 [Vitis vinifera] Length = 215 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FD TVGIHPSAAEEFVTMRSV+RRI G KPK +L Sbjct: 172 LKCGATKAQFDCTVGIHPSAAEEFVTMRSVTRRIAAGNKPKTNL 215 >gb|AHG97672.1| glutathione reductase [Boehmeria nivea] Length = 497 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK+ FDSTVGIHPSAAEEFVTMR+ SRR+ GKPK +L Sbjct: 454 LKCGATKEQFDSTVGIHPSAAEEFVTMRTESRRVSGSGKPKTNL 497 >ref|XP_004134003.1| PREDICTED: glutathione reductase, cytosolic-like isoform 1 [Cucumis sativus] gi|449432434|ref|XP_004134004.1| PREDICTED: glutathione reductase, cytosolic-like isoform 2 [Cucumis sativus] gi|449487522|ref|XP_004157668.1| PREDICTED: glutathione reductase, cytosolic-like isoform 1 [Cucumis sativus] gi|449487524|ref|XP_004157669.1| PREDICTED: glutathione reductase, cytosolic-like isoform 2 [Cucumis sativus] Length = 496 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATKK FDSTVGIHPSAAEEFVTMRSV+RRI G K K +L Sbjct: 453 LKCGATKKQFDSTVGIHPSAAEEFVTMRSVTRRIEAGCKLKTNL 496 >gb|ADM96038.1| glutathione reductase [Cucumis sativus] Length = 496 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATKK FDSTVGIHPSAAEEFVTMRSV+RRI G K K +L Sbjct: 453 LKCGATKKQFDSTVGIHPSAAEEFVTMRSVTRRIEAGCKLKTNL 496 >gb|AGY14485.1| glutathione reductase, partial [Cicer arietinum] Length = 382 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVG+HPSAAEEFVTMRSV+RR+ KPK +L Sbjct: 339 LKCGATKAQFDSTVGVHPSAAEEFVTMRSVTRRVTAAAKPKTNL 382 >ref|XP_004954330.1| PREDICTED: glutathione reductase, cytosolic-like [Setaria italica] Length = 494 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVGIHPSAAEEFVTMR+++RR+ P KPK L Sbjct: 451 LKCGATKANFDSTVGIHPSAAEEFVTMRTLTRRVSPTSKPKTSL 494 >ref|XP_004514690.1| PREDICTED: glutathione reductase, cytosolic-like [Cicer arietinum] Length = 498 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -2 Query: 667 LKCGATKKIFDSTVGIHPSAAEEFVTMRSVSRRIPPGGKPKADL 536 LKCGATK FDSTVG+HPSAAEEFVTMRSV+RR+ KPK +L Sbjct: 455 LKCGATKAQFDSTVGVHPSAAEEFVTMRSVTRRVTAAAKPKTNL 498