BLASTX nr result
ID: Papaver25_contig00017878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00017878 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594394.1| F-box protein [Medicago truncatula] gi|35548... 57 2e-06 ref|XP_006487929.1| PREDICTED: F-box protein CPR30-like [Citrus ... 57 3e-06 >ref|XP_003594394.1| F-box protein [Medicago truncatula] gi|355483442|gb|AES64645.1| F-box protein [Medicago truncatula] Length = 418 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 1/85 (1%) Frame = -3 Query: 418 EKLMDVPLPEKSIMYPEDSNTRLFK-KVGVLGDCLSLVLVDTKLVRAEVWVMQEYGARES 242 E +VPLP++ E+ N++ FK +V LG CL ++ VD K + +VWVM+EYG RES Sbjct: 259 ETFNEVPLPDE---IEEEVNSKSFKIRVAALGGCLCMI-VDYKDTKIDVWVMKEYGCRES 314 Query: 241 WTKLLITSQTPYTSIPFCMPVMSLK 167 W KL ++ F +P+ SL+ Sbjct: 315 WCKLFTVVKS-----SFDLPLQSLR 334 >ref|XP_006487929.1| PREDICTED: F-box protein CPR30-like [Citrus sinensis] Length = 370 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 2/77 (2%) Frame = -3 Query: 421 NEKLMDVPLPEKSIMYPEDSNTRLFKKVGVLGDCLSLVLVDTKLVRA--EVWVMQEYGAR 248 NE VPLP+ M E S+ F + VLG CLS+ V+ + +VWVM+EYG + Sbjct: 224 NENFFVVPLPDD--MTNEKSSFTNFSNLSVLGGCLSVTCVNRTNINDCYDVWVMKEYGIK 281 Query: 247 ESWTKLLITSQTPYTSI 197 ESWTKL ++P SI Sbjct: 282 ESWTKLFSFPRSPKESI 298