BLASTX nr result
ID: Papaver25_contig00017873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00017873 (581 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 58 2e-06 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +1 Query: 145 MADESTLNCXXXXXXXXXXXXGVFLKFGCQIEFWICLILTFF 270 MADE T NC GVFLKFGC +EFWICL+LTFF Sbjct: 1 MADEGTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFF 42