BLASTX nr result
ID: Papaver25_contig00017658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00017658 (742 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321659.2| hypothetical protein POPTR_0015s09960g [Popu... 57 5e-06 ref|XP_004299176.1| PREDICTED: probable Ufm1-specific protease-l... 57 9e-06 >ref|XP_002321659.2| hypothetical protein POPTR_0015s09960g [Populus trichocarpa] gi|550322403|gb|EEF05786.2| hypothetical protein POPTR_0015s09960g [Populus trichocarpa] Length = 656 Score = 57.4 bits (137), Expect = 5e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 269 LCPYHFYPPGMLHPITAIHELNYGENEMKQ 358 LC YHF PPG+LHPIT I+ELNYGE E+KQ Sbjct: 366 LCSYHFNPPGLLHPITVIYELNYGETELKQ 395 >ref|XP_004299176.1| PREDICTED: probable Ufm1-specific protease-like [Fragaria vesca subsp. vesca] Length = 645 Score = 56.6 bits (135), Expect = 9e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 269 LCPYHFYPPGMLHPITAIHELNYGENEMKQ 358 L PYHF PPG+LHPIT I+ELNYGE EMKQ Sbjct: 359 LHPYHFNPPGVLHPITVIYELNYGETEMKQ 388