BLASTX nr result
ID: Papaver25_contig00016364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00016364 (733 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006493133.1| PREDICTED: outer envelope pore protein 37, c... 59 1e-06 ref|XP_006442039.1| hypothetical protein CICLE_v10021021mg [Citr... 59 1e-06 ref|XP_006442038.1| hypothetical protein CICLE_v10021021mg [Citr... 59 1e-06 ref|XP_002275927.2| PREDICTED: uncharacterized protein LOC100264... 58 4e-06 emb|CBI24755.3| unnamed protein product [Vitis vinifera] 58 4e-06 ref|XP_007153902.1| hypothetical protein PHAVU_003G074500g [Phas... 57 5e-06 ref|NP_850405.2| chloroplast outer envelope protein 37 [Arabidop... 57 9e-06 ref|XP_002881941.1| hypothetical protein ARALYDRAFT_483513 [Arab... 57 9e-06 ref|NP_973684.1| chloroplast outer envelope protein 37 [Arabidop... 57 9e-06 ref|NP_566003.1| chloroplast outer envelope protein 37 [Arabidop... 57 9e-06 >ref|XP_006493133.1| PREDICTED: outer envelope pore protein 37, chloroplastic-like [Citrus sinensis] Length = 338 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = -3 Query: 620 TSSSFSFP-RPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQIGF 444 TSS FSFP RPA+R+ +K+SCK+FD+LAK K+SF N G+I +PQ+ F Sbjct: 40 TSSLFSFPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAF 99 >ref|XP_006442039.1| hypothetical protein CICLE_v10021021mg [Citrus clementina] gi|557544301|gb|ESR55279.1| hypothetical protein CICLE_v10021021mg [Citrus clementina] Length = 338 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = -3 Query: 620 TSSSFSFP-RPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQIGF 444 TSS FSFP RPA+R+ +K+SCK+FD+LAK K+SF N G+I +PQ+ F Sbjct: 40 TSSLFSFPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAF 99 >ref|XP_006442038.1| hypothetical protein CICLE_v10021021mg [Citrus clementina] gi|557544300|gb|ESR55278.1| hypothetical protein CICLE_v10021021mg [Citrus clementina] Length = 268 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = -3 Query: 620 TSSSFSFP-RPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQIGF 444 TSS FSFP RPA+R+ +K+SCK+FD+LAK K+SF N G+I +PQ+ F Sbjct: 40 TSSLFSFPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAF 99 >ref|XP_002275927.2| PREDICTED: uncharacterized protein LOC100264576 [Vitis vinifera] Length = 328 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -3 Query: 596 RPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQIGFL 441 RP+IR+ F+K+SCK+FD+LAK KLSF N+ +GEI DPQ+GF+ Sbjct: 39 RPSIRLTSEFDSDSSIFFHKISCKLFDSLAKLKLSFQNNNDGEIFDPQLGFI 90 >emb|CBI24755.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -3 Query: 596 RPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQIGFL 441 RP+IR+ F+K+SCK+FD+LAK KLSF N+ +GEI DPQ+GF+ Sbjct: 36 RPSIRLTSEFDSDSSIFFHKISCKLFDSLAKLKLSFQNNNDGEIFDPQLGFI 87 >ref|XP_007153902.1| hypothetical protein PHAVU_003G074500g [Phaseolus vulgaris] gi|561027256|gb|ESW25896.1| hypothetical protein PHAVU_003G074500g [Phaseolus vulgaris] Length = 347 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 608 FSFPR-PAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQIGFL 441 FSFPR PA+R+ F+K+SCK+ DNLAKFKL F +S G+I++PQI F+ Sbjct: 53 FSFPRRPALRVTSEFDSESAVFFHKISCKLLDNLAKFKLQFNHSGKGDIAEPQISFV 109 >ref|NP_850405.2| chloroplast outer envelope protein 37 [Arabidopsis thaliana] gi|330255260|gb|AEC10354.1| chloroplast outer envelope protein 37 [Arabidopsis thaliana] Length = 333 Score = 56.6 bits (135), Expect = 9e-06 Identities = 29/62 (46%), Positives = 35/62 (56%) Frame = -3 Query: 629 CSITSSSFSFPRPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQI 450 CS S + RP +R+ NKVSCK+FDNLAK KLSF N+ EIS PQ+ Sbjct: 41 CSTLSFLKTANRPKLRVTSEFDSDSLLFLNKVSCKLFDNLAKLKLSFQNNSQREISQPQV 100 Query: 449 GF 444 F Sbjct: 101 SF 102 >ref|XP_002881941.1| hypothetical protein ARALYDRAFT_483513 [Arabidopsis lyrata subsp. lyrata] gi|297327780|gb|EFH58200.1| hypothetical protein ARALYDRAFT_483513 [Arabidopsis lyrata subsp. lyrata] Length = 347 Score = 56.6 bits (135), Expect = 9e-06 Identities = 29/62 (46%), Positives = 35/62 (56%) Frame = -3 Query: 629 CSITSSSFSFPRPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQI 450 CS S + RP +R+ NKVSCK+FDNLAK KLSF N+ EIS PQ+ Sbjct: 45 CSTLSFLKTANRPKLRVTSEFDSDSLLFLNKVSCKLFDNLAKLKLSFQNNSQREISQPQV 104 Query: 449 GF 444 F Sbjct: 105 SF 106 >ref|NP_973684.1| chloroplast outer envelope protein 37 [Arabidopsis thaliana] gi|330255259|gb|AEC10353.1| chloroplast outer envelope protein 37 [Arabidopsis thaliana] Length = 280 Score = 56.6 bits (135), Expect = 9e-06 Identities = 29/62 (46%), Positives = 35/62 (56%) Frame = -3 Query: 629 CSITSSSFSFPRPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQI 450 CS S + RP +R+ NKVSCK+FDNLAK KLSF N+ EIS PQ+ Sbjct: 41 CSTLSFLKTANRPKLRVTSEFDSDSLLFLNKVSCKLFDNLAKLKLSFQNNSQREISQPQV 100 Query: 449 GF 444 F Sbjct: 101 SF 102 >ref|NP_566003.1| chloroplast outer envelope protein 37 [Arabidopsis thaliana] gi|75099806|sp|O80565.2|OEP37_ARATH RecName: Full=Outer envelope pore protein 37, chloroplastic; AltName: Full=Chloroplastic outer envelope pore protein of 37 kDa; Short=AtOEP37; Flags: Precursor gi|15028229|gb|AAK76611.1| unknown protein [Arabidopsis thaliana] gi|19310819|gb|AAL85140.1| unknown protein [Arabidopsis thaliana] gi|20197072|gb|AAC23403.2| expressed protein [Arabidopsis thaliana] gi|330255258|gb|AEC10352.1| chloroplast outer envelope protein 37 [Arabidopsis thaliana] Length = 343 Score = 56.6 bits (135), Expect = 9e-06 Identities = 29/62 (46%), Positives = 35/62 (56%) Frame = -3 Query: 629 CSITSSSFSFPRPAIRIXXXXXXXXXXXFNKVSCKVFDNLAKFKLSFLNSKNGEISDPQI 450 CS S + RP +R+ NKVSCK+FDNLAK KLSF N+ EIS PQ+ Sbjct: 41 CSTLSFLKTANRPKLRVTSEFDSDSLLFLNKVSCKLFDNLAKLKLSFQNNSQREISQPQV 100 Query: 449 GF 444 F Sbjct: 101 SF 102