BLASTX nr result
ID: Papaver25_contig00016121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00016121 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18223.3| unnamed protein product [Vitis vinifera] 72 1e-10 ref|XP_002265125.1| PREDICTED: 60S ribosomal protein L3-like [Vi... 72 1e-10 emb|CAN63848.1| hypothetical protein VITISV_039858 [Vitis vinifera] 72 1e-10 ref|XP_002524302.1| 60S ribosomal protein L3, putative [Ricinus ... 71 2e-10 gb|EXB30757.1| 60S ribosomal protein L3 [Morus notabilis] 71 2e-10 ref|XP_006492588.1| PREDICTED: 60S ribosomal protein L3-2-like [... 71 2e-10 ref|XP_006349325.1| PREDICTED: 60S ribosomal protein L3-2-like i... 71 2e-10 ref|XP_006434488.1| hypothetical protein CICLE_v10001454mg [Citr... 71 2e-10 ref|XP_006431637.1| hypothetical protein CICLE_v10001453mg [Citr... 71 2e-10 ref|XP_006431636.1| hypothetical protein CICLE_v10001453mg [Citr... 71 2e-10 ref|XP_006391991.1| hypothetical protein EUTSA_v10023521mg [Eutr... 71 2e-10 ref|XP_007041218.1| R-protein L3 B isoform 2, partial [Theobroma... 71 2e-10 ref|XP_007041217.1| R-protein L3 B isoform 1 [Theobroma cacao] g... 71 2e-10 ref|XP_004504742.1| PREDICTED: 60S ribosomal protein L3-like [Ci... 71 2e-10 ref|XP_004230449.1| PREDICTED: 60S ribosomal protein L3-like [So... 71 2e-10 ref|NP_001275276.1| 60S ribosomal protein L3-like [Solanum tuber... 71 2e-10 gb|AFG47248.1| hypothetical protein 2_207_02, partial [Pinus taeda] 71 2e-10 gb|AEW08123.1| hypothetical protein 2_207_02, partial [Pinus rad... 71 2e-10 ref|XP_002302168.1| ribosomal protein 1 [Populus trichocarpa] gi... 71 2e-10 gb|ABK23172.1| unknown [Picea sitchensis] 71 2e-10 >emb|CBI18223.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 89 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGS 125 >ref|XP_002265125.1| PREDICTED: 60S ribosomal protein L3-like [Vitis vinifera] Length = 397 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 37 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGS 73 >emb|CAN63848.1| hypothetical protein VITISV_039858 [Vitis vinifera] Length = 389 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_002524302.1| 60S ribosomal protein L3, putative [Ricinus communis] gi|223536393|gb|EEF38042.1| 60S ribosomal protein L3, putative [Ricinus communis] Length = 389 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDP+KPC+LTAFLGYKA MTHIMREVEK GS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIMREVEKPGS 65 >gb|EXB30757.1| 60S ribosomal protein L3 [Morus notabilis] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_006492588.1| PREDICTED: 60S ribosomal protein L3-2-like [Citrus sinensis] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPCRLTAFLGYKA MTHI+R+VEK GS Sbjct: 29 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGS 65 >ref|XP_006349325.1| PREDICTED: 60S ribosomal protein L3-2-like isoform X1 [Solanum tuberosum] gi|565365243|ref|XP_006349326.1| PREDICTED: 60S ribosomal protein L3-2-like isoform X2 [Solanum tuberosum] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_006434488.1| hypothetical protein CICLE_v10001454mg [Citrus clementina] gi|568838147|ref|XP_006473077.1| PREDICTED: 60S ribosomal protein L3-like [Citrus sinensis] gi|557536610|gb|ESR47728.1| hypothetical protein CICLE_v10001454mg [Citrus clementina] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPCRLTAFLGYKA MTHI+R+VEK GS Sbjct: 29 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGS 65 >ref|XP_006431637.1| hypothetical protein CICLE_v10001453mg [Citrus clementina] gi|557533759|gb|ESR44877.1| hypothetical protein CICLE_v10001453mg [Citrus clementina] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPCRLTAFLGYKA MTHI+R+VEK GS Sbjct: 29 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGS 65 >ref|XP_006431636.1| hypothetical protein CICLE_v10001453mg [Citrus clementina] gi|557533758|gb|ESR44876.1| hypothetical protein CICLE_v10001453mg [Citrus clementina] Length = 318 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPCRLTAFLGYKA MTHI+R+VEK GS Sbjct: 29 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGS 65 >ref|XP_006391991.1| hypothetical protein EUTSA_v10023521mg [Eutrema salsugineum] gi|557088497|gb|ESQ29277.1| hypothetical protein EUTSA_v10023521mg [Eutrema salsugineum] Length = 385 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPCRLT+FLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCRLTSFLGYKAGMTHIVREVEKPGS 65 >ref|XP_007041218.1| R-protein L3 B isoform 2, partial [Theobroma cacao] gi|508705153|gb|EOX97049.1| R-protein L3 B isoform 2, partial [Theobroma cacao] Length = 285 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_007041217.1| R-protein L3 B isoform 1 [Theobroma cacao] gi|508705152|gb|EOX97048.1| R-protein L3 B isoform 1 [Theobroma cacao] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_004504742.1| PREDICTED: 60S ribosomal protein L3-like [Cicer arietinum] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VKSFPKDDP+KPCRLTAF+GYKA MTHI+REVEK GS Sbjct: 29 VKSFPKDDPTKPCRLTAFVGYKAGMTHIVREVEKPGS 65 >ref|XP_004230449.1| PREDICTED: 60S ribosomal protein L3-like [Solanum lycopersicum] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|NP_001275276.1| 60S ribosomal protein L3-like [Solanum tuberosum] gi|82623411|gb|ABB87120.1| ribosomal protein L3-like [Solanum tuberosum] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VK+FPKDDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|AFG47248.1| hypothetical protein 2_207_02, partial [Pinus taeda] Length = 143 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VKSFP+DDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 33 VKSFPRDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 69 >gb|AEW08123.1| hypothetical protein 2_207_02, partial [Pinus radiata] gi|383132710|gb|AFG47249.1| hypothetical protein 2_207_02, partial [Pinus taeda] Length = 143 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VKSFP+DDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 33 VKSFPRDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 69 >ref|XP_002302168.1| ribosomal protein 1 [Populus trichocarpa] gi|118483469|gb|ABK93633.1| unknown [Populus trichocarpa] gi|222843894|gb|EEE81441.1| ribosomal protein 1 [Populus trichocarpa] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VKSFPKDDP+KPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKSFPKDDPNKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|ABK23172.1| unknown [Picea sitchensis] Length = 389 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 457 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 567 VKSFP+DDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKSFPRDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 65