BLASTX nr result
ID: Papaver25_contig00015977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00015977 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60068.1| hypothetical protein VITISV_012400 [Vitis vinifera] 119 6e-25 ref|XP_002283148.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1... 118 1e-24 ref|XP_002520539.1| protein binding protein, putative [Ricinus c... 114 1e-23 gb|EXB65259.1| E3 ubiquitin-protein ligase [Morus notabilis] 112 5e-23 ref|XP_002283232.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1... 112 5e-23 ref|XP_002531577.1| protein binding protein, putative [Ricinus c... 112 5e-23 emb|CAN72193.1| hypothetical protein VITISV_022309 [Vitis vinifera] 112 5e-23 ref|XP_004307484.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1... 112 7e-23 ref|NP_191112.1| E3 ubiquitin-protein ligase SDIR1 [Arabidopsis ... 111 9e-23 ref|XP_004138475.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1... 111 9e-23 gb|ADN34069.1| protein binding protein [Cucumis melo subsp. melo] 111 9e-23 ref|XP_007163423.1| hypothetical protein PHAVU_001G233500g [Phas... 111 1e-22 ref|XP_002315216.1| zinc finger family protein [Populus trichoca... 110 2e-22 ref|XP_006291667.1| hypothetical protein CARUB_v10017826mg [Caps... 110 3e-22 ref|XP_006291666.1| hypothetical protein CARUB_v10017826mg [Caps... 110 3e-22 ref|XP_002878037.1| zinc finger family protein [Arabidopsis lyra... 109 3e-22 ref|XP_006488366.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1... 109 4e-22 ref|XP_006424874.1| hypothetical protein CICLE_v10030412mg [Citr... 109 4e-22 ref|XP_007016361.1| Binding protein, putative isoform 3 [Theobro... 109 4e-22 ref|XP_007016359.1| Binding protein, putative isoform 1 [Theobro... 109 4e-22 >emb|CAN60068.1| hypothetical protein VITISV_012400 [Vitis vinifera] Length = 262 Score = 119 bits (297), Expect = 6e-25 Identities = 53/66 (80%), Positives = 58/66 (87%), Gaps = 1/66 (1%) Frame = -3 Query: 386 GEAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFR- 210 G + AS AP+DELTCSVCLEQVN GE+IR+LPCLHQFH+ CIDPWLRQQGTCPVCKFR Sbjct: 185 GSSSASAEAPDDELTCSVCLEQVNVGELIRSLPCLHQFHANCIDPWLRQQGTCPVCKFRA 244 Query: 209 ANGWQE 192 A GWQE Sbjct: 245 APGWQE 250 >ref|XP_002283148.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Vitis vinifera] gi|296086209|emb|CBI31650.3| unnamed protein product [Vitis vinifera] Length = 275 Score = 118 bits (295), Expect = 1e-24 Identities = 54/69 (78%), Positives = 58/69 (84%), Gaps = 1/69 (1%) Frame = -3 Query: 395 QVFGEAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCK 216 Q A AS AP+DELTCSVCLEQVN GE+IR+LPCLHQFH+ CIDPWLRQQGTCPVCK Sbjct: 195 QDINNAVASTKAPDDELTCSVCLEQVNVGELIRSLPCLHQFHANCIDPWLRQQGTCPVCK 254 Query: 215 FR-ANGWQE 192 FR A GWQE Sbjct: 255 FRAAPGWQE 263 >ref|XP_002520539.1| protein binding protein, putative [Ricinus communis] gi|223540381|gb|EEF41952.1| protein binding protein, putative [Ricinus communis] Length = 397 Score = 114 bits (285), Expect = 1e-23 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 1/65 (1%) Frame = -3 Query: 383 EAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFR-A 207 ++E + A EDELTCS+CLEQVN+GEI+R+LPCLHQFH+ CIDPWLRQQGTCPVCKFR Sbjct: 196 KSEGTVKALEDELTCSICLEQVNKGEIVRSLPCLHQFHTNCIDPWLRQQGTCPVCKFRIG 255 Query: 206 NGWQE 192 +GWQE Sbjct: 256 SGWQE 260 >gb|EXB65259.1| E3 ubiquitin-protein ligase [Morus notabilis] Length = 239 Score = 112 bits (280), Expect = 5e-23 Identities = 50/64 (78%), Positives = 55/64 (85%), Gaps = 1/64 (1%) Frame = -3 Query: 380 AEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA-N 204 A + A EDELTCSVCLEQVN GE+IR+LPCLHQFH+ CIDPWLRQQGTCPVCKFRA + Sbjct: 164 AAGNTKASEDELTCSVCLEQVNVGELIRSLPCLHQFHANCIDPWLRQQGTCPVCKFRAGS 223 Query: 203 GWQE 192 GW E Sbjct: 224 GWHE 227 >ref|XP_002283232.2| PREDICTED: E3 ubiquitin-protein ligase SDIR1 [Vitis vinifera] gi|297746043|emb|CBI16099.3| unnamed protein product [Vitis vinifera] Length = 279 Score = 112 bits (280), Expect = 5e-23 Identities = 48/67 (71%), Positives = 56/67 (83%), Gaps = 1/67 (1%) Frame = -3 Query: 383 EAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRAN 204 + ++S EDELTCS+CLEQVN GE++R+LPCLHQFH+ CIDPWLRQQGTCPVCKFR Sbjct: 203 KGDSSMKGSEDELTCSICLEQVNRGELVRSLPCLHQFHANCIDPWLRQQGTCPVCKFRVG 262 Query: 203 -GWQE*R 186 GWQE R Sbjct: 263 AGWQESR 269 >ref|XP_002531577.1| protein binding protein, putative [Ricinus communis] gi|223528807|gb|EEF30813.1| protein binding protein, putative [Ricinus communis] Length = 276 Score = 112 bits (280), Expect = 5e-23 Identities = 51/64 (79%), Positives = 54/64 (84%), Gaps = 1/64 (1%) Frame = -3 Query: 380 AEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFR-AN 204 A S A EDELTCSVCLEQVN GE+IR LPCLHQFH+ CIDPWLRQQGTCPVCKFR A+ Sbjct: 201 AVGSMKASEDELTCSVCLEQVNVGELIRTLPCLHQFHANCIDPWLRQQGTCPVCKFRAAS 260 Query: 203 GWQE 192 GW E Sbjct: 261 GWHE 264 >emb|CAN72193.1| hypothetical protein VITISV_022309 [Vitis vinifera] Length = 1218 Score = 112 bits (280), Expect = 5e-23 Identities = 48/67 (71%), Positives = 56/67 (83%), Gaps = 1/67 (1%) Frame = -3 Query: 383 EAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRAN 204 + ++S EDELTCS+CLEQVN GE++R+LPCLHQFH+ CIDPWLRQQGTCPVCKFR Sbjct: 858 KGDSSMKGSEDELTCSICLEQVNRGELVRSLPCLHQFHANCIDPWLRQQGTCPVCKFRVG 917 Query: 203 -GWQE*R 186 GWQE R Sbjct: 918 AGWQESR 924 >ref|XP_004307484.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Fragaria vesca subsp. vesca] Length = 275 Score = 112 bits (279), Expect = 7e-23 Identities = 49/61 (80%), Positives = 56/61 (91%), Gaps = 1/61 (1%) Frame = -3 Query: 371 SPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA-NGWQ 195 S A EDELTCSVCLEQVN GE+IR+LPCLHQFH++CIDPWL+QQGTCPVCK+RA +GWQ Sbjct: 202 STKAIEDELTCSVCLEQVNAGELIRSLPCLHQFHASCIDPWLKQQGTCPVCKYRAGSGWQ 261 Query: 194 E 192 E Sbjct: 262 E 262 >ref|NP_191112.1| E3 ubiquitin-protein ligase SDIR1 [Arabidopsis thaliana] gi|75311810|sp|Q9M2S6.1|SDIR1_ARATH RecName: Full=E3 ubiquitin-protein ligase SDIR1; AltName: Full=Protein salt- and drought-induced RING finger1 gi|14423516|gb|AAK62440.1|AF386995_1 putative protein [Arabidopsis thaliana] gi|7076796|emb|CAB75911.1| putative protein [Arabidopsis thaliana] gi|30023760|gb|AAP13413.1| At3g55530 [Arabidopsis thaliana] gi|222423557|dbj|BAH19748.1| AT3G55530 [Arabidopsis thaliana] gi|332645876|gb|AEE79397.1| E3 ubiquitin-protein ligase SDIR1 [Arabidopsis thaliana] Length = 273 Score = 111 bits (278), Expect = 9e-23 Identities = 50/71 (70%), Positives = 56/71 (78%), Gaps = 1/71 (1%) Frame = -3 Query: 401 SNQVFGEAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPV 222 + ++ A S EDELTCSVCLEQV GEI+R LPCLHQFH+ CIDPWLRQQGTCPV Sbjct: 191 AEKMLDSANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQFHAGCIDPWLRQQGTCPV 250 Query: 221 CKFRA-NGWQE 192 CKFRA +GWQE Sbjct: 251 CKFRAHSGWQE 261 >ref|XP_004138475.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Cucumis sativus] Length = 275 Score = 111 bits (278), Expect = 9e-23 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 1/64 (1%) Frame = -3 Query: 380 AEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA-N 204 A S EDELTCSVCLEQVN GE+IR+LPCLHQFH+ CIDPWLRQQGTCPVCKFRA + Sbjct: 201 AVGSTKTSEDELTCSVCLEQVNVGELIRSLPCLHQFHANCIDPWLRQQGTCPVCKFRAVS 260 Query: 203 GWQE 192 GW E Sbjct: 261 GWSE 264 >gb|ADN34069.1| protein binding protein [Cucumis melo subsp. melo] Length = 275 Score = 111 bits (278), Expect = 9e-23 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 1/64 (1%) Frame = -3 Query: 380 AEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA-N 204 A S EDELTCSVCLEQVN GE+IR+LPCLHQFH+ CIDPWLRQQGTCPVCKFRA + Sbjct: 201 AVGSTKTSEDELTCSVCLEQVNVGELIRSLPCLHQFHANCIDPWLRQQGTCPVCKFRAVS 260 Query: 203 GWQE 192 GW E Sbjct: 261 GWSE 264 >ref|XP_007163423.1| hypothetical protein PHAVU_001G233500g [Phaseolus vulgaris] gi|561036887|gb|ESW35417.1| hypothetical protein PHAVU_001G233500g [Phaseolus vulgaris] Length = 273 Score = 111 bits (277), Expect = 1e-22 Identities = 50/68 (73%), Positives = 58/68 (85%), Gaps = 1/68 (1%) Frame = -3 Query: 380 AEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA-N 204 A S A +DELTCSVCLEQVN GE++R+LPCLHQFH++CIDPWLRQQGTCPVCKFRA + Sbjct: 200 AVGSMKASDDELTCSVCLEQVNVGEVLRSLPCLHQFHASCIDPWLRQQGTCPVCKFRAGS 259 Query: 203 GWQE*RGH 180 GW + GH Sbjct: 260 GWSD-NGH 266 >ref|XP_002315216.1| zinc finger family protein [Populus trichocarpa] gi|222864256|gb|EEF01387.1| zinc finger family protein [Populus trichocarpa] Length = 276 Score = 110 bits (275), Expect = 2e-22 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = -3 Query: 386 GEAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA 207 G A S + +DELTCSVCLEQV+ GE+IR LPCLHQFH+ CIDPWLRQQGTCPVCKFRA Sbjct: 199 GNAIGSMKSSDDELTCSVCLEQVSMGEVIRTLPCLHQFHANCIDPWLRQQGTCPVCKFRA 258 Query: 206 -NGWQE 192 +GW E Sbjct: 259 GSGWNE 264 >ref|XP_006291667.1| hypothetical protein CARUB_v10017826mg [Capsella rubella] gi|482560374|gb|EOA24565.1| hypothetical protein CARUB_v10017826mg [Capsella rubella] Length = 272 Score = 110 bits (274), Expect = 3e-22 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 1/61 (1%) Frame = -3 Query: 371 SPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA-NGWQ 195 S EDELTCSVCLEQV GEI+R LPCLHQFH+ CIDPWLRQQGTCPVCKFRA +GWQ Sbjct: 200 SKKGTEDELTCSVCLEQVTAGEIVRTLPCLHQFHAGCIDPWLRQQGTCPVCKFRAHSGWQ 259 Query: 194 E 192 E Sbjct: 260 E 260 >ref|XP_006291666.1| hypothetical protein CARUB_v10017826mg [Capsella rubella] gi|482560373|gb|EOA24564.1| hypothetical protein CARUB_v10017826mg [Capsella rubella] Length = 271 Score = 110 bits (274), Expect = 3e-22 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 1/61 (1%) Frame = -3 Query: 371 SPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA-NGWQ 195 S EDELTCSVCLEQV GEI+R LPCLHQFH+ CIDPWLRQQGTCPVCKFRA +GWQ Sbjct: 199 SKKGTEDELTCSVCLEQVTAGEIVRTLPCLHQFHAGCIDPWLRQQGTCPVCKFRAHSGWQ 258 Query: 194 E 192 E Sbjct: 259 E 259 >ref|XP_002878037.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297323875|gb|EFH54296.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 272 Score = 109 bits (273), Expect = 3e-22 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 1/61 (1%) Frame = -3 Query: 371 SPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRA-NGWQ 195 S EDELTCSVCLEQV GEI+R LPCLHQFH+ CIDPWLRQQGTCPVCKFRA +GWQ Sbjct: 200 SKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQFHAGCIDPWLRQQGTCPVCKFRAHSGWQ 259 Query: 194 E 192 E Sbjct: 260 E 260 >ref|XP_006488366.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like isoform X1 [Citrus sinensis] gi|568870347|ref|XP_006488367.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like isoform X2 [Citrus sinensis] Length = 278 Score = 109 bits (272), Expect = 4e-22 Identities = 48/73 (65%), Positives = 59/73 (80%), Gaps = 1/73 (1%) Frame = -3 Query: 401 SNQVFGEAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPV 222 S Q +A+ S + EDELTC++CLEQV GE++R+LPCLHQFH+ CIDPWLRQ+GTCPV Sbjct: 196 SKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPV 255 Query: 221 CKFR-ANGWQE*R 186 CKFR +GWQE R Sbjct: 256 CKFRMGSGWQENR 268 >ref|XP_006424874.1| hypothetical protein CICLE_v10030412mg [Citrus clementina] gi|557526808|gb|ESR38114.1| hypothetical protein CICLE_v10030412mg [Citrus clementina] Length = 279 Score = 109 bits (272), Expect = 4e-22 Identities = 48/73 (65%), Positives = 59/73 (80%), Gaps = 1/73 (1%) Frame = -3 Query: 401 SNQVFGEAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPV 222 S Q +A+ S + EDELTC++CLEQV GE++R+LPCLHQFH+ CIDPWLRQ+GTCPV Sbjct: 197 SKQESKKADGSTKSSEDELTCTICLEQVKCGELVRSLPCLHQFHANCIDPWLRQRGTCPV 256 Query: 221 CKFR-ANGWQE*R 186 CKFR +GWQE R Sbjct: 257 CKFRMGSGWQENR 269 >ref|XP_007016361.1| Binding protein, putative isoform 3 [Theobroma cacao] gi|508786724|gb|EOY33980.1| Binding protein, putative isoform 3 [Theobroma cacao] Length = 205 Score = 109 bits (272), Expect = 4e-22 Identities = 46/67 (68%), Positives = 57/67 (85%), Gaps = 1/67 (1%) Frame = -3 Query: 383 EAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRAN 204 +A+ S A EDELTC++CL+QVN GE++R+LPCLHQFH++CIDPWLRQQGTCPVCKF+ Sbjct: 129 KADGSMKASEDELTCTICLDQVNRGELVRSLPCLHQFHASCIDPWLRQQGTCPVCKFKMG 188 Query: 203 G-WQE*R 186 WQE R Sbjct: 189 SVWQENR 195 >ref|XP_007016359.1| Binding protein, putative isoform 1 [Theobroma cacao] gi|590589122|ref|XP_007016360.1| Binding protein, putative isoform 1 [Theobroma cacao] gi|508786722|gb|EOY33978.1| Binding protein, putative isoform 1 [Theobroma cacao] gi|508786723|gb|EOY33979.1| Binding protein, putative isoform 1 [Theobroma cacao] Length = 276 Score = 109 bits (272), Expect = 4e-22 Identities = 46/67 (68%), Positives = 57/67 (85%), Gaps = 1/67 (1%) Frame = -3 Query: 383 EAEASPMAPEDELTCSVCLEQVNEGEIIRALPCLHQFHSTCIDPWLRQQGTCPVCKFRAN 204 +A+ S A EDELTC++CL+QVN GE++R+LPCLHQFH++CIDPWLRQQGTCPVCKF+ Sbjct: 200 KADGSMKASEDELTCTICLDQVNRGELVRSLPCLHQFHASCIDPWLRQQGTCPVCKFKMG 259 Query: 203 G-WQE*R 186 WQE R Sbjct: 260 SVWQENR 266