BLASTX nr result
ID: Papaver25_contig00015477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00015477 (493 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007154165.1| hypothetical protein PHAVU_003G095800g [Phas... 92 6e-17 ref|XP_007154598.1| hypothetical protein PHAVU_003G132300g [Phas... 92 6e-17 ref|XP_006826960.1| hypothetical protein AMTR_s00010p00192110 [A... 92 6e-17 sp|Q9AT34.3|RS15A_DAUCA RecName: Full=40S ribosomal protein S15a... 92 6e-17 emb|CBI31713.3| unnamed protein product [Vitis vinifera] 92 6e-17 ref|XP_002279090.1| PREDICTED: 40S ribosomal protein S15a-like i... 92 6e-17 gb|EYU18937.1| hypothetical protein MIMGU_mgv1a016211mg [Mimulus... 91 2e-16 ref|NP_001059160.1| Os07g0208000 [Oryza sativa Japonica Group] g... 90 4e-16 ref|XP_006365436.1| PREDICTED: 40S ribosomal protein S15a-1 [Sol... 90 4e-16 ref|XP_007157164.1| hypothetical protein PHAVU_002G048000g [Phas... 90 4e-16 ref|XP_007147788.1| hypothetical protein PHAVU_006G155200g [Phas... 90 4e-16 ref|XP_006379579.1| hypothetical protein POPTR_0008s05190g [Popu... 90 4e-16 ref|XP_006848579.1| hypothetical protein AMTR_s00168p00026690 [A... 90 4e-16 ref|XP_004957741.1| PREDICTED: 40S ribosomal protein S15a-1-like... 90 4e-16 ref|XP_004957743.1| PREDICTED: 40S ribosomal protein S15a-1-like... 90 4e-16 ref|XP_004964986.1| PREDICTED: 40S ribosomal protein S15a-1-like... 90 4e-16 ref|XP_004513036.1| PREDICTED: 40S ribosomal protein S15a-1-like... 90 4e-16 ref|XP_004503959.1| PREDICTED: 40S ribosomal protein S15a-1-like... 90 4e-16 ref|XP_004307554.1| PREDICTED: 40S ribosomal protein S15a-1-like... 90 4e-16 ref|NP_001275136.1| uncharacterized protein LOC102577793 [Solanu... 90 4e-16 >ref|XP_007154165.1| hypothetical protein PHAVU_003G095800g [Phaseolus vulgaris] gi|561027519|gb|ESW26159.1| hypothetical protein PHAVU_003G095800g [Phaseolus vulgaris] Length = 174 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 491 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 132 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 174 >ref|XP_007154598.1| hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] gi|561027952|gb|ESW26592.1| hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] Length = 130 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 491 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 88 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006826960.1| hypothetical protein AMTR_s00010p00192110 [Amborella trichopoda] gi|548831389|gb|ERM94197.1| hypothetical protein AMTR_s00010p00192110 [Amborella trichopoda] Length = 130 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 491 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 88 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >sp|Q9AT34.3|RS15A_DAUCA RecName: Full=40S ribosomal protein S15a gi|13560779|gb|AAK30203.1|AF349962_1 cytoplasmic ribosomal protein S15a [Daucus carota] Length = 130 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 491 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 88 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >emb|CBI31713.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 491 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 133 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 175 >ref|XP_002279090.1| PREDICTED: 40S ribosomal protein S15a-like isoform 1 [Vitis vinifera] gi|225449601|ref|XP_002284061.1| PREDICTED: 40S ribosomal protein S15a-like [Vitis vinifera] gi|359481341|ref|XP_003632608.1| PREDICTED: 40S ribosomal protein S15a-like isoform 2 [Vitis vinifera] gi|147781237|emb|CAN65143.1| hypothetical protein VITISV_007037 [Vitis vinifera] gi|147790711|emb|CAN76515.1| hypothetical protein VITISV_017255 [Vitis vinifera] gi|297741553|emb|CBI32685.3| unnamed protein product [Vitis vinifera] Length = 130 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 491 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 88 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|EYU18937.1| hypothetical protein MIMGU_mgv1a016211mg [Mimulus guttatus] gi|604305419|gb|EYU24563.1| hypothetical protein MIMGU_mgv1a016215mg [Mimulus guttatus] gi|604331399|gb|EYU36257.1| hypothetical protein MIMGU_mgv1a016232mg [Mimulus guttatus] Length = 130 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 491 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 88 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 130 >ref|NP_001059160.1| Os07g0208000 [Oryza sativa Japonica Group] gi|573950515|ref|XP_006657549.1| PREDICTED: 40S ribosomal protein S15a-1-like [Oryza brachyantha] gi|582044878|pdb|3J60|W Chain W, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome gi|28411802|dbj|BAC57277.1| ribosomal protein S15 [Oryza sativa Japonica Group] gi|113610696|dbj|BAF21074.1| Os07g0208000 [Oryza sativa Japonica Group] gi|125557646|gb|EAZ03182.1| hypothetical protein OsI_25335 [Oryza sativa Indica Group] gi|125599505|gb|EAZ39081.1| hypothetical protein OsJ_23513 [Oryza sativa Japonica Group] gi|215693112|dbj|BAG88494.1| unnamed protein product [Oryza sativa Japonica Group] Length = 130 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_006365436.1| PREDICTED: 40S ribosomal protein S15a-1 [Solanum tuberosum] Length = 118 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 77 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 118 >ref|XP_007157164.1| hypothetical protein PHAVU_002G048000g [Phaseolus vulgaris] gi|561030579|gb|ESW29158.1| hypothetical protein PHAVU_002G048000g [Phaseolus vulgaris] Length = 130 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_007147788.1| hypothetical protein PHAVU_006G155200g [Phaseolus vulgaris] gi|561021011|gb|ESW19782.1| hypothetical protein PHAVU_006G155200g [Phaseolus vulgaris] Length = 183 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 142 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 183 >ref|XP_006379579.1| hypothetical protein POPTR_0008s05190g [Populus trichocarpa] gi|550332461|gb|ERP57376.1| hypothetical protein POPTR_0008s05190g [Populus trichocarpa] Length = 105 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 64 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 105 >ref|XP_006848579.1| hypothetical protein AMTR_s00168p00026690 [Amborella trichopoda] gi|548851901|gb|ERN10160.1| hypothetical protein AMTR_s00168p00026690 [Amborella trichopoda] Length = 167 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 491 PWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 PWTARLLPSRQFG+IVLTTSAGIMDH+EARRKNVGGKVLGFFY Sbjct: 125 PWTARLLPSRQFGFIVLTTSAGIMDHDEARRKNVGGKVLGFFY 167 >ref|XP_004957741.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Setaria italica] Length = 162 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 121 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 162 >ref|XP_004957743.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X4 [Setaria italica] gi|514809577|ref|XP_004979610.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] Length = 130 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004964986.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Setaria italica] gi|514762255|ref|XP_004964987.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Setaria italica] Length = 130 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004513036.1| PREDICTED: 40S ribosomal protein S15a-1-like [Cicer arietinum] gi|514749501|ref|XP_004961874.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] gi|514784116|ref|XP_004970511.1| PREDICTED: 40S ribosomal protein S15a-1-like [Setaria italica] Length = 130 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004503959.1| PREDICTED: 40S ribosomal protein S15a-1-like [Cicer arietinum] Length = 130 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_004307554.1| PREDICTED: 40S ribosomal protein S15a-1-like [Fragaria vesca subsp. vesca] Length = 130 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|NP_001275136.1| uncharacterized protein LOC102577793 [Solanum tuberosum] gi|357125783|ref|XP_003564569.1| PREDICTED: 40S ribosomal protein S15a-1-like [Brachypodium distachyon] gi|357133356|ref|XP_003568291.1| PREDICTED: 40S ribosomal protein S15a-1-like [Brachypodium distachyon] gi|470116878|ref|XP_004294600.1| PREDICTED: 40S ribosomal protein S15a-1-like [Fragaria vesca subsp. vesca] gi|502125485|ref|XP_004498944.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Cicer arietinum] gi|502125487|ref|XP_004498945.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Cicer arietinum] gi|565380677|ref|XP_006356722.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X1 [Solanum tuberosum] gi|565380679|ref|XP_006356723.1| PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Solanum tuberosum] gi|565381980|ref|XP_006357333.1| PREDICTED: 40S ribosomal protein S15a-1-like [Solanum tuberosum] gi|565381982|ref|XP_006357334.1| PREDICTED: 40S ribosomal protein S15a-1-like [Solanum tuberosum] gi|76573307|gb|ABA46758.1| unknown [Solanum tuberosum] gi|77745497|gb|ABB02647.1| unknown [Solanum tuberosum] gi|301641374|gb|ADK87348.1| 40S ribosomal protein S15a [Triticum aestivum] gi|388511815|gb|AFK43969.1| unknown [Medicago truncatula] gi|474186081|gb|EMS57914.1| 40S ribosomal protein S15a-1 [Triticum urartu] gi|475534291|gb|EMT08545.1| 40S ribosomal protein S15a-1 [Aegilops tauschii] gi|475603932|gb|EMT25572.1| 40S ribosomal protein S15a-1 [Aegilops tauschii] Length = 130 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 488 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 363 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130