BLASTX nr result
ID: Papaver25_contig00014605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00014605 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006439086.1| hypothetical protein CICLE_v10031893mg [Citr... 55 8e-06 ref|XP_006439083.1| hypothetical protein CICLE_v10031893mg [Citr... 55 8e-06 >ref|XP_006439086.1| hypothetical protein CICLE_v10031893mg [Citrus clementina] gi|557541282|gb|ESR52326.1| hypothetical protein CICLE_v10031893mg [Citrus clementina] Length = 365 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -3 Query: 422 KQKEMYKGIYGKRPEPKKETNQKKNLLAVFWLWILSLFGRFFKPQKQRVD 273 KQKE+YKGI+G RPEPK Q+ N L +FW W++SL R FK ++ + + Sbjct: 320 KQKEIYKGIFGPRPEPK----QENNWLIIFWQWLVSLVLRLFKRKRVKAE 365 >ref|XP_006439083.1| hypothetical protein CICLE_v10031893mg [Citrus clementina] gi|557541279|gb|ESR52323.1| hypothetical protein CICLE_v10031893mg [Citrus clementina] Length = 266 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -3 Query: 422 KQKEMYKGIYGKRPEPKKETNQKKNLLAVFWLWILSLFGRFFKPQKQRVD 273 KQKE+YKGI+G RPEPK Q+ N L +FW W++SL R FK ++ + + Sbjct: 221 KQKEIYKGIFGPRPEPK----QENNWLIIFWQWLVSLVLRLFKRKRVKAE 266