BLASTX nr result
ID: Papaver25_contig00014394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00014394 (916 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phas... 62 3e-07 ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801... 62 3e-07 ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Sela... 62 3e-07 ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Sela... 62 3e-07 gb|EXB53619.1| Casein kinase I [Morus notabilis] 62 4e-07 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis] 62 4e-07 ref|XP_007030718.1| Kinase family protein [Theobroma cacao] gi|5... 62 4e-07 ref|XP_002325416.1| kinase family protein [Populus trichocarpa] ... 62 4e-07 ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504... 61 5e-07 emb|CBI16476.3| unnamed protein product [Vitis vinifera] 61 5e-07 ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263... 61 5e-07 ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [A... 61 7e-07 ref|XP_001764211.1| predicted protein [Physcomitrella patens] gi... 61 7e-07 ref|XP_001770883.1| predicted protein [Physcomitrella patens] gi... 61 7e-07 gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Mimulus... 60 9e-07 ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619... 60 9e-07 ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603... 60 9e-07 ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citr... 60 9e-07 ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [A... 60 9e-07 ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290... 60 9e-07 >ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris] gi|561035401|gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris] Length = 708 Score = 62.0 bits (149), Expect = 3e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS +GP AVE+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 170 GSDRTGPDAVEVALKFEHRNSKGCNYGPPYEWQVY 204 >ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine max] gi|571525577|ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine max] Length = 709 Score = 62.0 bits (149), Expect = 3e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS +GP AVE+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 171 GSDRTGPDAVEVALKFEHRNSKGCNYGPPYEWQVY 205 >ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii] gi|300171833|gb|EFJ38433.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii] Length = 596 Score = 62.0 bits (149), Expect = 3e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS +GP AVE+ LKF+H++SKGCNYGPPY WQVY Sbjct: 58 GSERTGPQAVEVALKFEHRSSKGCNYGPPYEWQVY 92 >ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii] gi|300165110|gb|EFJ31718.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii] Length = 596 Score = 62.0 bits (149), Expect = 3e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS +GP AVE+ LKF+H++SKGCNYGPPY WQVY Sbjct: 58 GSERTGPQAVEVALKFEHRSSKGCNYGPPYEWQVY 92 >gb|EXB53619.1| Casein kinase I [Morus notabilis] Length = 801 Score = 61.6 bits (148), Expect = 4e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 10 TSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 TSGP+A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 182 TSGPSAMEVALKFEHRNSKGCNYGPPYEWQVY 213 >gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis] Length = 706 Score = 61.6 bits (148), Expect = 4e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 170 GSDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 204 >ref|XP_007030718.1| Kinase family protein [Theobroma cacao] gi|508719323|gb|EOY11220.1| Kinase family protein [Theobroma cacao] Length = 705 Score = 61.6 bits (148), Expect = 4e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 167 GSDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 201 >ref|XP_002325416.1| kinase family protein [Populus trichocarpa] gi|222862291|gb|EEE99797.1| kinase family protein [Populus trichocarpa] Length = 720 Score = 61.6 bits (148), Expect = 4e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 166 GSDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 200 >ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer arietinum] gi|502107088|ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer arietinum] Length = 708 Score = 61.2 bits (147), Expect = 5e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 170 GSERTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 204 >emb|CBI16476.3| unnamed protein product [Vitis vinifera] Length = 603 Score = 61.2 bits (147), Expect = 5e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 10 TSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 TSGP+A E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 64 TSGPSATEVALKFEHRNSKGCNYGPPYEWQVY 95 >ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263956 [Vitis vinifera] Length = 714 Score = 61.2 bits (147), Expect = 5e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 10 TSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 TSGP+A E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 175 TSGPSATEVALKFEHRNSKGCNYGPPYEWQVY 206 >ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda] gi|548844272|gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda] Length = 705 Score = 60.8 bits (146), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 G+ +GP AVE+ LKF+H++SKGCNYGPPY WQVY Sbjct: 167 GTERTGPDAVEVALKFEHRSSKGCNYGPPYEWQVY 201 >ref|XP_001764211.1| predicted protein [Physcomitrella patens] gi|162684651|gb|EDQ71052.1| predicted protein [Physcomitrella patens] Length = 603 Score = 60.8 bits (146), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 G+ +GP AVE+ LKF+H++SKGCNYGPPY WQVY Sbjct: 61 GAERTGPQAVEVALKFEHRSSKGCNYGPPYEWQVY 95 >ref|XP_001770883.1| predicted protein [Physcomitrella patens] gi|162677747|gb|EDQ64213.1| predicted protein [Physcomitrella patens] Length = 603 Score = 60.8 bits (146), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 G+ +GP AVE+ LKF+H++SKGCNYGPPY WQVY Sbjct: 61 GTERTGPQAVEVALKFEHRSSKGCNYGPPYEWQVY 95 >gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Mimulus guttatus] Length = 706 Score = 60.5 bits (145), Expect = 9e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 G+G +GP A+E+ LK +H++SKGCNYGPPY WQVY Sbjct: 168 GTGRTGPDAIEVALKCEHRSSKGCNYGPPYEWQVY 202 >ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus sinensis] Length = 708 Score = 60.5 bits (145), Expect = 9e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 166 GSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 200 >ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum] Length = 709 Score = 60.5 bits (145), Expect = 9e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 G+ +GP AVE+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 171 GTERTGPDAVEVALKFEHRNSKGCNYGPPYEWQVY 205 >ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina] gi|568850840|ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus sinensis] gi|557545680|gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina] Length = 704 Score = 60.5 bits (145), Expect = 9e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 GS GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 166 GSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 200 >ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda] gi|548857320|gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda] Length = 703 Score = 60.5 bits (145), Expect = 9e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +1 Query: 10 TSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 T+GP A+E+ LKF+H++SKGCNYGPPY WQVY Sbjct: 164 TTGPGAIEVALKFEHRSSKGCNYGPPYEWQVY 195 >ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca subsp. vesca] Length = 692 Score = 60.5 bits (145), Expect = 9e-07 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 1 GSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 105 G+ +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 154 GTDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 188