BLASTX nr result
ID: Papaver25_contig00014176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00014176 (746 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004500518.1| PREDICTED: uncharacterized protein LOC101509... 61 5e-07 ref|XP_004514177.1| PREDICTED: uncharacterized protein LOC101496... 60 1e-06 ref|XP_004515069.1| PREDICTED: uncharacterized protein LOC101493... 59 2e-06 ref|XP_004240230.1| PREDICTED: uncharacterized protein LOC101251... 59 2e-06 gb|AFK48925.1| unknown [Medicago truncatula] 59 2e-06 ref|XP_003600979.1| hypothetical protein MTR_3g071650 [Medicago ... 59 2e-06 ref|XP_002277384.2| PREDICTED: uncharacterized protein LOC100262... 59 2e-06 emb|CAN83741.1| hypothetical protein VITISV_031206 [Vitis vinifera] 59 2e-06 ref|XP_007218045.1| hypothetical protein PRUPE_ppa006124mg [Prun... 57 7e-06 >ref|XP_004500518.1| PREDICTED: uncharacterized protein LOC101509082 [Cicer arietinum] Length = 404 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 241 RIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 RIVRK SINK Y KGADI++FNTYIWWITG K K+L Sbjct: 202 RIVRKGSINKHGRYWKGADIVVFNTYIWWITGSKMKIL 239 >ref|XP_004514177.1| PREDICTED: uncharacterized protein LOC101496508 [Cicer arietinum] Length = 504 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 241 RIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 RIVRK SINK + Y KG DI++FNTYIWWITG K K+L Sbjct: 321 RIVRKGSINKHDRYWKGTDIVVFNTYIWWITGSKMKIL 358 >ref|XP_004515069.1| PREDICTED: uncharacterized protein LOC101493938 [Cicer arietinum] Length = 160 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 241 RIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 RIVRK SI+K Y KGADI++FNTYIWWITG K K+L Sbjct: 68 RIVRKGSISKHGRYWKGADIVVFNTYIWWITGSKMKIL 105 >ref|XP_004240230.1| PREDICTED: uncharacterized protein LOC101251781 [Solanum lycopersicum] Length = 418 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 247 KKRIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 ++R+VRK+SIN +Y KGADI++FNTYIWW TG KF +L Sbjct: 214 EERVVRKDSINTHGKYWKGADIIVFNTYIWWRTGFKFNIL 253 >gb|AFK48925.1| unknown [Medicago truncatula] Length = 249 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 241 RIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 RIVRK SINK Y KGADIL+FNTY+WW+TG K+L Sbjct: 47 RIVRKGSINKHGRYWKGADILVFNTYLWWVTGSNMKIL 84 >ref|XP_003600979.1| hypothetical protein MTR_3g071650 [Medicago truncatula] gi|355490027|gb|AES71230.1| hypothetical protein MTR_3g071650 [Medicago truncatula] Length = 433 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 241 RIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 RIVRK SINK Y KGADIL+FNTY+WW+TG K+L Sbjct: 231 RIVRKGSINKHGRYWKGADILVFNTYLWWVTGSNMKIL 268 >ref|XP_002277384.2| PREDICTED: uncharacterized protein LOC100262072 [Vitis vinifera] gi|297736550|emb|CBI25421.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 241 RIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 RIVRK SINK +Y KG DIL+FNTY+WW+TG K K+L Sbjct: 217 RIVRKGSINKHGKYWKGVDILVFNTYLWWMTGLKMKIL 254 >emb|CAN83741.1| hypothetical protein VITISV_031206 [Vitis vinifera] Length = 409 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 241 RIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 RIVRK SINK +Y KG DIL+FNTY+WW+TG K K+L Sbjct: 207 RIVRKGSINKHGKYWKGVDILVFNTYLWWMTGLKMKIL 244 >ref|XP_007218045.1| hypothetical protein PRUPE_ppa006124mg [Prunus persica] gi|462414507|gb|EMJ19244.1| hypothetical protein PRUPE_ppa006124mg [Prunus persica] Length = 426 Score = 57.0 bits (136), Expect = 7e-06 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -2 Query: 286 NTVVKKIRSTLQKKKRIVRKESINKFNEYRKGADILLFNTYIWWITG*KFKML 128 N VV +I +R+VRK SI K ++ KG D+L+FNTY+WW+TG KFK+L Sbjct: 215 NAVVHRI------SERLVRKGSITKHGKHWKGVDVLVFNTYLWWMTGLKFKIL 261