BLASTX nr result
ID: Papaver25_contig00013616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00013616 (572 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297119.1| PREDICTED: 60S ribosomal protein L13a-4-like... 63 5e-08 ref|XP_004288082.1| PREDICTED: 60S ribosomal protein L13a-4-like... 63 5e-08 gb|EXC25125.1| 60S ribosomal protein L13a-3 [Morus notabilis] 63 6e-08 gb|EXC16937.1| 60S ribosomal protein L13a-4 [Morus notabilis] 63 6e-08 ref|XP_007223449.1| hypothetical protein PRUPE_ppa011551mg [Prun... 63 6e-08 ref|XP_007223448.1| hypothetical protein PRUPE_ppa011551mg [Prun... 63 6e-08 emb|CBI17324.3| unnamed protein product [Vitis vinifera] 62 1e-07 emb|CBI37325.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002267491.1| PREDICTED: 60S ribosomal protein L13a-4 [Vit... 62 1e-07 ref|XP_002268901.1| PREDICTED: 60S ribosomal protein L13a-4 [Vit... 62 1e-07 ref|XP_004168353.1| PREDICTED: 60S ribosomal protein L13a-3-like... 62 1e-07 ref|XP_004154637.1| PREDICTED: 60S ribosomal protein L13a-4-like... 62 1e-07 ref|XP_004154636.1| PREDICTED: 60S ribosomal protein L13a-4-like... 62 1e-07 ref|XP_004138959.1| PREDICTED: 60S ribosomal protein L13a-4-like... 62 1e-07 ref|XP_004133995.1| PREDICTED: 60S ribosomal protein L13a-2-like... 62 1e-07 gb|EYU31410.1| hypothetical protein MIMGU_mgv1a013934mg [Mimulus... 61 2e-07 ref|XP_006349931.1| PREDICTED: 60S ribosomal protein L13a-4-like... 61 2e-07 ref|XP_004298287.1| PREDICTED: 60S ribosomal protein L13a-3-like... 61 2e-07 ref|XP_004252998.1| PREDICTED: 60S ribosomal protein L13a-4-like... 61 2e-07 ref|XP_004247847.1| PREDICTED: 60S ribosomal protein L13a-4-like... 61 2e-07 >ref|XP_004297119.1| PREDICTED: 60S ribosomal protein L13a-4-like [Fragaria vesca subsp. vesca] Length = 206 Score = 63.2 bits (152), Expect = 5e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEGIPPPYDKIKRMVIPD Sbjct: 97 TKRGAAALARLKAYEGIPPPYDKIKRMVIPD 127 >ref|XP_004288082.1| PREDICTED: 60S ribosomal protein L13a-4-like [Fragaria vesca subsp. vesca] gi|470103309|ref|XP_004288083.1| PREDICTED: 60S ribosomal protein L13a-4-like [Fragaria vesca subsp. vesca] Length = 206 Score = 63.2 bits (152), Expect = 5e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEGIPPPYDKIKRMVIPD Sbjct: 97 TKRGAAALARLKAYEGIPPPYDKIKRMVIPD 127 >gb|EXC25125.1| 60S ribosomal protein L13a-3 [Morus notabilis] Length = 206 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEGIPPPYDKIKRMV+PD Sbjct: 97 TKRGAAALARLKAYEGIPPPYDKIKRMVVPD 127 >gb|EXC16937.1| 60S ribosomal protein L13a-4 [Morus notabilis] Length = 271 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEG+PPPYDKIKRMVIPD Sbjct: 162 TKRGAAALARLKAYEGVPPPYDKIKRMVIPD 192 >ref|XP_007223449.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica] gi|462420385|gb|EMJ24648.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica] Length = 206 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEG+PPPYDKIKRMVIPD Sbjct: 97 TKRGAAALARLKAYEGVPPPYDKIKRMVIPD 127 >ref|XP_007223448.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica] gi|462420384|gb|EMJ24647.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica] Length = 187 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEG+PPPYDKIKRMVIPD Sbjct: 97 TKRGAAALARLKAYEGVPPPYDKIKRMVIPD 127 >emb|CBI17324.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEGIPPPYDK+KRMVIPD Sbjct: 31 TKRGAAALARLKAYEGIPPPYDKMKRMVIPD 61 >emb|CBI37325.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEGIPPPYDK+KRMVIPD Sbjct: 31 TKRGAAALARLKAYEGIPPPYDKMKRMVIPD 61 >ref|XP_002267491.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera] Length = 206 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEGIPPPYDK+KRMVIPD Sbjct: 97 TKRGAAALARLKAYEGIPPPYDKMKRMVIPD 127 >ref|XP_002268901.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera] gi|147801437|emb|CAN63603.1| hypothetical protein VITISV_006449 [Vitis vinifera] Length = 206 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEGIPPPYDK+KRMVIPD Sbjct: 97 TKRGAAALARLKAYEGIPPPYDKMKRMVIPD 127 >ref|XP_004168353.1| PREDICTED: 60S ribosomal protein L13a-3-like, partial [Cucumis sativus] Length = 137 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEG+PPPYDK+KRMVIPD Sbjct: 28 TKRGAAALARLKAYEGVPPPYDKMKRMVIPD 58 >ref|XP_004154637.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 2 [Cucumis sativus] gi|449476094|ref|XP_004154638.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 3 [Cucumis sativus] Length = 208 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEG+PPPYDK+KRMVIPD Sbjct: 97 TKRGAAALARLKAYEGVPPPYDKMKRMVIPD 127 >ref|XP_004154636.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 1 [Cucumis sativus] Length = 241 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEG+PPPYDK+KRMVIPD Sbjct: 130 TKRGAAALARLKAYEGVPPPYDKMKRMVIPD 160 >ref|XP_004138959.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus] gi|449442541|ref|XP_004139040.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus] Length = 206 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEG+PPPYDK+KRMVIPD Sbjct: 97 TKRGAAALARLKAYEGVPPPYDKMKRMVIPD 127 >ref|XP_004133995.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus] gi|449525004|ref|XP_004169511.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus] Length = 206 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R KAYEG+PPPYDK+KRMVIPD Sbjct: 97 TKRGAAALARLKAYEGVPPPYDKMKRMVIPD 127 >gb|EYU31410.1| hypothetical protein MIMGU_mgv1a013934mg [Mimulus guttatus] Length = 206 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R K YEG+PPPYDKIKRMVIPD Sbjct: 97 TKRGAAALARLKVYEGVPPPYDKIKRMVIPD 127 >ref|XP_006349931.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum] Length = 206 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R K YEG+PPPYDKIKRMVIPD Sbjct: 97 TKRGAAALARLKVYEGVPPPYDKIKRMVIPD 127 >ref|XP_004298287.1| PREDICTED: 60S ribosomal protein L13a-3-like [Fragaria vesca subsp. vesca] Length = 160 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 398 KRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 KRGAAAL R KAYEGIPPPYDKIKRMVIPD Sbjct: 52 KRGAAALARLKAYEGIPPPYDKIKRMVIPD 81 >ref|XP_004252998.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum lycopersicum] Length = 206 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R K YEG+PPPYDKIKRMVIPD Sbjct: 97 TKRGAAALARLKVYEGVPPPYDKIKRMVIPD 127 >ref|XP_004247847.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum lycopersicum] gi|565389213|ref|XP_006360354.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum] Length = 206 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 401 TKRGAAALVRFKAYEGIPPPYDKIKRMVIPD 309 TKRGAAAL R K YEG+PPPYDKIKRMVIPD Sbjct: 97 TKRGAAALARLKVYEGVPPPYDKIKRMVIPD 127