BLASTX nr result
ID: Papaver25_contig00013161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00013161 (1086 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844691.1| hypothetical protein AMTR_s00016p00245620 [A... 62 5e-07 >ref|XP_006844691.1| hypothetical protein AMTR_s00016p00245620 [Amborella trichopoda] gi|548847162|gb|ERN06366.1| hypothetical protein AMTR_s00016p00245620 [Amborella trichopoda] Length = 535 Score = 61.6 bits (148), Expect = 5e-07 Identities = 47/132 (35%), Positives = 62/132 (46%), Gaps = 1/132 (0%) Frame = -2 Query: 422 VAEEYRQKTWKPKFNIEK*KQKADEAGTCVISLNSRKGYLRSFTSLRTFLSWLITSSRYM 243 VAE+YR+K WKPKF EK K+KA+EA S Sbjct: 387 VAEQYREKAWKPKFEAEKEKEKAEEAALAASS---------------------------- 418 Query: 242 *VTALTSEQNKFAFSYNFKLCDSSL*HFRLIELCLTEIYQI-MHDNIEKGEKQLNITIGI 66 L+ Q K F +K+ D + + Y+I + D IEKGEKQ N+TIGI Sbjct: 419 ---GLSGFQKK-VFDLLYKIAD----------VPFLDAYKIKIIDAIEKGEKQPNLTIGI 464 Query: 65 LVSIALVMLTSI 30 LV++ LV LT+I Sbjct: 465 LVAVLLVFLTAI 476