BLASTX nr result
ID: Papaver25_contig00012348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00012348 (863 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004507667.1| PREDICTED: peroxidase 29-like [Cicer arietinum] 60 1e-06 ref|XP_003550481.1| PREDICTED: peroxidase 29-like [Glycine max] 59 2e-06 ref|XP_003528697.2| PREDICTED: peroxidase 29-like [Glycine max] 59 2e-06 ref|XP_006843805.1| hypothetical protein AMTR_s00007p00253160 [A... 58 4e-06 >ref|XP_004507667.1| PREDICTED: peroxidase 29-like [Cicer arietinum] Length = 325 Score = 59.7 bits (143), Expect = 1e-06 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = -1 Query: 530 VNESQLAHGHYQTSCPNVEALIKDTLVPIFWTDATAAASISRLLFRDCQFQ 378 + ++QL++ +Y+ SCPN+E+ IK L+ +F TDATA A+ RL+F DCQ Q Sbjct: 24 IKQNQLSYNYYKLSCPNLESTIKKELLTLFLTDATAPAAFLRLMFHDCQVQ 74 >ref|XP_003550481.1| PREDICTED: peroxidase 29-like [Glycine max] Length = 326 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/51 (50%), Positives = 38/51 (74%) Frame = -1 Query: 530 VNESQLAHGHYQTSCPNVEALIKDTLVPIFWTDATAAASISRLLFRDCQFQ 378 + +QL++ +Y+ SCPN+E++IK L+ IF TDATA A+ RL+F DCQ Q Sbjct: 23 IKANQLSYDYYKFSCPNLESVIKSELLGIFLTDATAPAAFLRLMFHDCQVQ 73 >ref|XP_003528697.2| PREDICTED: peroxidase 29-like [Glycine max] Length = 327 Score = 58.9 bits (141), Expect = 2e-06 Identities = 24/51 (47%), Positives = 38/51 (74%) Frame = -1 Query: 530 VNESQLAHGHYQTSCPNVEALIKDTLVPIFWTDATAAASISRLLFRDCQFQ 378 + +QL++ +Y+ SCPN+E+++K L+ +F TDATA A+ RL+F DCQ Q Sbjct: 24 IKANQLSYDYYKFSCPNLESIVKSELLSLFLTDATAPAAFLRLMFHDCQVQ 74 >ref|XP_006843805.1| hypothetical protein AMTR_s00007p00253160 [Amborella trichopoda] gi|548846173|gb|ERN05480.1| hypothetical protein AMTR_s00007p00253160 [Amborella trichopoda] Length = 323 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/55 (45%), Positives = 38/55 (69%) Frame = -1 Query: 542 GY*CVNESQLAHGHYQTSCPNVEALIKDTLVPIFWTDATAAASISRLLFRDCQFQ 378 G+ V + L++ HY SCP++E+L+ TL+PIF TD T+ ++ RL+F DCQ Q Sbjct: 19 GFMDVTLANLSYDHYHNSCPHLESLVAKTLMPIFLTDPTSPSAFLRLMFHDCQVQ 73