BLASTX nr result
ID: Papaver25_contig00012026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00012026 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277180.1| PREDICTED: protein-tyrosine-phosphatase IBR5... 57 2e-06 >ref|XP_002277180.1| PREDICTED: protein-tyrosine-phosphatase IBR5 [Vitis vinifera] gi|297739238|emb|CBI28889.3| unnamed protein product [Vitis vinifera] Length = 272 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 110 LAYLMKCKGWRLAQSYQRVKEQRPSVEISQMFYK 9 +AYLMKCKGWR AQSYQ VKE+RPSVE+SQ ++ Sbjct: 138 IAYLMKCKGWRFAQSYQWVKERRPSVELSQAVHE 171