BLASTX nr result
ID: Papaver25_contig00012011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00012011 (652 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA41610.1| TPA: hypothetical protein ZEAMMB73_356414 [Zea m... 56 9e-06 >tpg|DAA41610.1| TPA: hypothetical protein ZEAMMB73_356414 [Zea mays] Length = 376 Score = 56.2 bits (134), Expect = 9e-06 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 1/80 (1%) Frame = -1 Query: 526 ALKVTDDILNSEAKLRALFKKWLSLNEVHHFDVDDRKAFEERFVIFKGKARHVNQHYK-K 350 AL +TD L SE + +L+++W S++ V D + + RF FK ARH+ + K K Sbjct: 27 ALLLTDKDLESEESMWSLYERWRSVHTVSR----DLREKQSRFEAFKANARHIGEFNKRK 82 Query: 349 NSTYTLMLTQFADLTKEEFV 290 + Y L L +FADLT+EEFV Sbjct: 83 DVPYKLGLNKFADLTQEEFV 102