BLASTX nr result
ID: Papaver25_contig00011972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00011972 (1507 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containi... 65 8e-08 emb|CBI26569.3| unnamed protein product [Vitis vinifera] 65 8e-08 ref|XP_006850860.1| hypothetical protein AMTR_s00025p00142780 [A... 64 1e-07 ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-07 ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-07 ref|XP_007029495.1| Pentatricopeptide repeat-containing protein,... 64 2e-07 ref|XP_006491815.1| PREDICTED: pentatricopeptide repeat-containi... 59 6e-06 ref|XP_006428506.1| hypothetical protein CICLE_v10011504mg [Citr... 59 6e-06 ref|XP_002519998.1| pentatricopeptide repeat-containing protein,... 59 7e-06 ref|XP_006590461.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-05 >ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Vitis vinifera] Length = 494 Score = 65.1 bits (157), Expect = 8e-08 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKR 1388 RA+KFD+V IYEEM+SAGCTPDRKARE+LQTAL VL++R Sbjct: 420 RARKFDKVPEIYEEMESAGCTPDRKAREMLQTALLVLQQR 459 >emb|CBI26569.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 65.1 bits (157), Expect = 8e-08 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKR 1388 RA+KFD+V IYEEM+SAGCTPDRKARE+LQTAL VL++R Sbjct: 341 RARKFDKVPEIYEEMESAGCTPDRKAREMLQTALLVLQQR 380 >ref|XP_006850860.1| hypothetical protein AMTR_s00025p00142780 [Amborella trichopoda] gi|548854531|gb|ERN12441.1| hypothetical protein AMTR_s00025p00142780 [Amborella trichopoda] Length = 416 Score = 64.3 bits (155), Expect = 1e-07 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKRQG 1382 RA+KFDQV +Y+EM+SAGC PDRKARE+LQ AL +LE+R G Sbjct: 372 RARKFDQVQEVYKEMESAGCVPDRKAREMLQNALLILEQRHG 413 >ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565369409|ref|XP_006351328.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565369411|ref|XP_006351329.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 523 Score = 63.9 bits (154), Expect = 2e-07 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKR 1388 RAKKFDQV IY EM+S GCTPDRKARE+LQ+AL +LE+R Sbjct: 482 RAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQR 521 >ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] Length = 523 Score = 63.9 bits (154), Expect = 2e-07 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKR 1388 RAKKFDQV IY EM+S GCTPDRKARE+LQ+AL +LE+R Sbjct: 482 RAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQR 521 >ref|XP_007029495.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508718100|gb|EOY09997.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 513 Score = 63.5 bits (153), Expect = 2e-07 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKR 1388 RAKKFD+V IY EM+S+GCTPDRKAR++LQTAL VLE+R Sbjct: 473 RAKKFDRVPEIYREMESSGCTPDRKARQMLQTALMVLEQR 512 >ref|XP_006491815.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Citrus sinensis] Length = 514 Score = 58.9 bits (141), Expect = 6e-06 Identities = 27/41 (65%), Positives = 37/41 (90%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKRQ 1385 RAKKF +V IY++M+S+GCTPDRKAR++LQ+AL VLE+R+ Sbjct: 474 RAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQRR 514 >ref|XP_006428506.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|567871835|ref|XP_006428507.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|557530563|gb|ESR41746.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|557530564|gb|ESR41747.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] Length = 514 Score = 58.9 bits (141), Expect = 6e-06 Identities = 27/41 (65%), Positives = 37/41 (90%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKRQ 1385 RAKKF +V IY++M+S+GCTPDRKAR++LQ+AL VLE+R+ Sbjct: 474 RAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQRR 514 >ref|XP_002519998.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540762|gb|EEF42322.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 498 Score = 58.5 bits (140), Expect = 7e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEKR 1388 RA+KFD+V IY EM+S+GCTPD+KARE+LQ AL VL +R Sbjct: 418 RARKFDEVPEIYSEMESSGCTPDKKAREILQAALMVLGRR 457 >ref|XP_006590461.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] Length = 414 Score = 58.2 bits (139), Expect = 1e-05 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 1507 RAKKFDQVLGIYEEMQSAGCTPDRKARELLQTALGVLEK 1391 RAKKFD+V IY+EM++ GCTPDRKAR++LQ AL VLE+ Sbjct: 373 RAKKFDEVPIIYKEMENDGCTPDRKARQMLQVALTVLER 411