BLASTX nr result
ID: Papaver25_contig00011863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00011863 (963 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006390899.1| hypothetical protein EUTSA_v10018064mg [Eutr... 60 1e-06 ref|XP_007022387.1| Leucine-rich repeat transmembrane protein ki... 60 2e-06 ref|XP_006392563.1| hypothetical protein EUTSA_v10012222mg, part... 59 3e-06 ref|XP_006392562.1| hypothetical protein EUTSA_v10011215mg [Eutr... 59 3e-06 emb|CBI20023.3| unnamed protein product [Vitis vinifera] 59 4e-06 ref|XP_006303851.1| hypothetical protein CARUB_v10012587mg, part... 58 5e-06 ref|XP_007214107.1| hypothetical protein PRUPE_ppa017049mg [Prun... 58 5e-06 ref|XP_007211340.1| hypothetical protein PRUPE_ppa001152mg [Prun... 58 5e-06 gb|AAG50909.1|AC069159_10 receptor protein kinase, putative [Ara... 58 5e-06 ref|NP_564709.2| leucine-rich repeat transmembrane protein kinas... 58 5e-06 gb|AAF02840.1|AC009894_11 Similar to serine/threonine kinases [A... 58 5e-06 gb|EXB53368.1| putative LRR receptor-like serine/threonine-prote... 58 6e-06 ref|XP_006853422.1| hypothetical protein AMTR_s00032p00163130 [A... 58 6e-06 ref|XP_002894561.1| leucine-rich repeat family protein [Arabidop... 58 6e-06 ref|NP_176008.4| Leucine-rich repeat transmembrane protein kinas... 58 6e-06 gb|AAF02836.1|AC009894_7 Very similar to receptor-like serine/th... 58 6e-06 >ref|XP_006390899.1| hypothetical protein EUTSA_v10018064mg [Eutrema salsugineum] gi|557087333|gb|ESQ28185.1| hypothetical protein EUTSA_v10018064mg [Eutrema salsugineum] Length = 1023 Score = 60.1 bits (144), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 SS RAV++ YK VS+NYLEIHLFW+GKGTCCI Sbjct: 566 SSIRAVQREYKANVSENYLEIHLFWAGKGTCCI 598 >ref|XP_007022387.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao] gi|508722015|gb|EOY13912.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao] Length = 1036 Score = 59.7 bits (143), Expect = 2e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 97 SNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S RAV K +K QVS+NYLEIHLFW+GKGTCC+ Sbjct: 573 SKRAVPKEFKAQVSENYLEIHLFWAGKGTCCV 604 >ref|XP_006392563.1| hypothetical protein EUTSA_v10012222mg, partial [Eutrema salsugineum] gi|557089141|gb|ESQ29849.1| hypothetical protein EUTSA_v10012222mg, partial [Eutrema salsugineum] Length = 986 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S+ RAV++ YK VS+NYLEIHLFW+GKGTCCI Sbjct: 557 STFRAVQREYKANVSENYLEIHLFWAGKGTCCI 589 >ref|XP_006392562.1| hypothetical protein EUTSA_v10011215mg [Eutrema salsugineum] gi|557089140|gb|ESQ29848.1| hypothetical protein EUTSA_v10011215mg [Eutrema salsugineum] Length = 929 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S+ RAV++ YK VS+NYLEIHLFW+GKGTCCI Sbjct: 460 STVRAVQREYKTNVSENYLEIHLFWAGKGTCCI 492 >emb|CBI20023.3| unnamed protein product [Vitis vinifera] Length = 349 Score = 58.5 bits (140), Expect = 4e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 97 SNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S RAV+K +K QVS+NY+EIHLFW+GKGTCC+ Sbjct: 204 SFRAVKKEFKAQVSENYIEIHLFWAGKGTCCV 235 >ref|XP_006303851.1| hypothetical protein CARUB_v10012587mg, partial [Capsella rubella] gi|482572562|gb|EOA36749.1| hypothetical protein CARUB_v10012587mg, partial [Capsella rubella] Length = 989 Score = 58.2 bits (139), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S+ RAV+K YK VS+N+LEIHLFW+GKGTCCI Sbjct: 526 STVRAVQKQYKANVSENHLEIHLFWAGKGTCCI 558 >ref|XP_007214107.1| hypothetical protein PRUPE_ppa017049mg [Prunus persica] gi|462409972|gb|EMJ15306.1| hypothetical protein PRUPE_ppa017049mg [Prunus persica] Length = 1053 Score = 58.2 bits (139), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 +S +AV+K Y QVS+NYLEIHLFW+GKGTCCI Sbjct: 583 ASFQAVQKEYAAQVSENYLEIHLFWAGKGTCCI 615 >ref|XP_007211340.1| hypothetical protein PRUPE_ppa001152mg [Prunus persica] gi|462407205|gb|EMJ12539.1| hypothetical protein PRUPE_ppa001152mg [Prunus persica] Length = 895 Score = 58.2 bits (139), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 94 NRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 NRAV K +KV VS+NYL+IHLFW+GKGTCCI Sbjct: 420 NRAVGKPFKVNVSENYLDIHLFWAGKGTCCI 450 >gb|AAG50909.1|AC069159_10 receptor protein kinase, putative [Arabidopsis thaliana] Length = 2062 Score = 58.2 bits (139), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S+ RAV++ YK VSQN+LEIHLFW+GKGTCCI Sbjct: 1596 STVRAVQREYKANVSQNHLEIHLFWAGKGTCCI 1628 >ref|NP_564709.2| leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] gi|264664587|sp|C0LGH3.2|Y5614_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At1g56140; Flags: Precursor gi|332195227|gb|AEE33348.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] Length = 1033 Score = 58.2 bits (139), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S+ RAV++ YK VSQN+LEIHLFW+GKGTCCI Sbjct: 567 STVRAVQREYKANVSQNHLEIHLFWAGKGTCCI 599 >gb|AAF02840.1|AC009894_11 Similar to serine/threonine kinases [Arabidopsis thaliana] Length = 1086 Score = 58.2 bits (139), Expect = 5e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S+ RAV++ YK VSQN+LEIHLFW+GKGTCCI Sbjct: 620 STVRAVQREYKANVSQNHLEIHLFWAGKGTCCI 652 >gb|EXB53368.1| putative LRR receptor-like serine/threonine-protein kinase [Morus notabilis] Length = 1105 Score = 57.8 bits (138), Expect = 6e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 97 SNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 S RAV+K YK VS NYLE+HLFW+GKGTCCI Sbjct: 603 SFRAVQKEYKALVSNNYLEVHLFWAGKGTCCI 634 >ref|XP_006853422.1| hypothetical protein AMTR_s00032p00163130 [Amborella trichopoda] gi|548857075|gb|ERN14889.1| hypothetical protein AMTR_s00032p00163130 [Amborella trichopoda] Length = 602 Score = 57.8 bits (138), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 SS RAV K YK V++N+LEIHLFW+GKGTCCI Sbjct: 131 SSFRAVSKTYKANVTENFLEIHLFWAGKGTCCI 163 >ref|XP_002894561.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297340403|gb|EFH70820.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 900 Score = 57.8 bits (138), Expect = 6e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 SS RAV++ YK VS+N+LE+HLFW+GKGTCCI Sbjct: 547 SSVRAVQREYKTNVSENHLEVHLFWAGKGTCCI 579 >ref|NP_176008.4| Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] gi|332195225|gb|AEE33346.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] Length = 1047 Score = 57.8 bits (138), Expect = 6e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 SS RAV++ YK VS+N+LE+HLFW+GKGTCCI Sbjct: 584 SSVRAVQREYKTNVSENHLEVHLFWAGKGTCCI 616 >gb|AAF02836.1|AC009894_7 Very similar to receptor-like serine/threonine kinase [Arabidopsis thaliana] Length = 858 Score = 57.8 bits (138), Expect = 6e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -3 Query: 100 SSNRAVEKNYKVQVSQNYLEIHLFWSGKGTCCI 2 SS RAV++ YK VS+N+LE+HLFW+GKGTCCI Sbjct: 395 SSVRAVQREYKTNVSENHLEVHLFWAGKGTCCI 427