BLASTX nr result
ID: Papaver25_contig00011521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00011521 (543 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212021.1| hypothetical protein PRUPE_ppa004899mg [Prun... 61 2e-07 ref|XP_006354698.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_007212021.1| hypothetical protein PRUPE_ppa004899mg [Prunus persica] gi|462407886|gb|EMJ13220.1| hypothetical protein PRUPE_ppa004899mg [Prunus persica] Length = 486 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/65 (47%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = +3 Query: 354 NSTPPFLQQSGLTRKPFLRISCVSA--KRKTGSVSEKSESQELVYLLLRNFKDQKPLIST 527 N T P+L L ++P RISCVS KRK G+ +E + +E+V +L+R+F D++PL+ T Sbjct: 26 NLTQPWLPHVLLRKRPVTRISCVSTRPKRKPGTKTEDPDVREVVRMLMRSFSDKEPLLKT 85 Query: 528 LNKYV 542 LNKYV Sbjct: 86 LNKYV 90 >ref|XP_006354698.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565376411|ref|XP_006354699.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X2 [Solanum tuberosum] gi|565376413|ref|XP_006354700.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X3 [Solanum tuberosum] Length = 457 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/53 (56%), Positives = 38/53 (71%), Gaps = 3/53 (5%) Frame = +3 Query: 393 RKPFLRISCVSAK---RKTGSVSEKSESQELVYLLLRNFKDQKPLISTLNKYV 542 R F I CVS + RK+G S SE+QELV L++RNF D+KPL+STL+KYV Sbjct: 10 RPVFSIIHCVSTRPGGRKSGYGSSSSEAQELVTLVMRNFSDKKPLVSTLDKYV 62