BLASTX nr result
ID: Papaver25_contig00011296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00011296 (597 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL68972.1| calmodulin-like-domain protein kinase CPK2 [Cucur... 58 2e-06 gb|EYU40484.1| hypothetical protein MIMGU_mgv1a004107mg [Mimulus... 58 2e-06 gb|EPS61686.1| calcium dependent protein kinase 5, partial [Genl... 58 2e-06 dbj|BAB16888.1| OsCDPK7 [Oryza sativa Japonica Group] gi|3834427... 57 3e-06 ref|XP_006652699.1| PREDICTED: calcium-dependent protein kinase ... 57 3e-06 ref|XP_006647698.1| PREDICTED: calcium-dependent protein kinase ... 57 3e-06 ref|XP_004976604.1| PREDICTED: calcium-dependent protein kinase ... 57 3e-06 ref|XP_004953480.1| PREDICTED: calcium-dependent protein kinase ... 57 3e-06 gb|AGJ83811.1| calcium-dependent protein kinase 3d [Vitis amuren... 57 3e-06 gb|EMT26589.1| Calcium-dependent protein kinase 5 [Aegilops taus... 57 3e-06 gb|EMT18908.1| Calcium-dependent protein kinase 5 [Aegilops taus... 57 3e-06 gb|EMS53623.1| Calcium-dependent protein kinase 5 [Triticum urartu] 57 3e-06 gb|EMS52553.1| Calcium-dependent protein kinase 5 [Triticum urartu] 57 3e-06 ref|NP_001105307.1| Calcium-dependent protein kinase [Zea mays] ... 57 3e-06 ref|NP_001105304.1| calcium dependent protein kinase [Zea mays] ... 57 3e-06 gb|AFW63436.1| putative calcium-dependent protein kinase family ... 57 3e-06 gb|AFW63434.1| putative calcium-dependent protein kinase family ... 57 3e-06 gb|AFV30233.1| calcium-dependent protein kinase [Triticum aestivum] 57 3e-06 gb|AFR54115.1| calcium-dependent protein kinase 3-like protein, ... 57 3e-06 ref|XP_003580397.1| PREDICTED: calcium-dependent protein kinase ... 57 3e-06 >gb|AAL68972.1| calmodulin-like-domain protein kinase CPK2 [Cucurbita maxima] Length = 558 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDYSEFVAMM KG+ G GRRTMRNSLNL Sbjct: 519 DGRIDYSEFVAMMQKGNAGIGRRTMRNSLNL 549 >gb|EYU40484.1| hypothetical protein MIMGU_mgv1a004107mg [Mimulus guttatus] Length = 543 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 504 DGRIDYGEFVAMMTKGNAGVGRRTMRNSLNI 534 >gb|EPS61686.1| calcium dependent protein kinase 5, partial [Genlisea aurea] Length = 479 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 440 DGRIDYGEFVAMMTKGNAGVGRRTMRNSLNM 470 >dbj|BAB16888.1| OsCDPK7 [Oryza sativa Japonica Group] gi|38344274|emb|CAE03753.2| OSJNBa0013K16.2 [Oryza sativa Japonica Group] gi|215692742|dbj|BAG88162.1| unnamed protein product [Oryza sativa Japonica Group] gi|218195438|gb|EEC77865.1| hypothetical protein OsI_17131 [Oryza sativa Indica Group] gi|315666561|gb|ADU55583.1| calcium-dependent protein kinase [synthetic construct] Length = 551 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 512 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 542 >ref|XP_006652699.1| PREDICTED: calcium-dependent protein kinase 5-like [Oryza brachyantha] Length = 515 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 476 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 506 >ref|XP_006647698.1| PREDICTED: calcium-dependent protein kinase 5-like [Oryza brachyantha] Length = 544 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 511 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 541 >ref|XP_004976604.1| PREDICTED: calcium-dependent protein kinase 4-like [Setaria italica] Length = 556 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 517 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 547 >ref|XP_004953480.1| PREDICTED: calcium-dependent protein kinase 5-like [Setaria italica] Length = 559 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 520 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 550 >gb|AGJ83811.1| calcium-dependent protein kinase 3d [Vitis amurensis] Length = 561 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDYSEFVAMM KG+ G GRRTMRNSLN+ Sbjct: 522 DGRIDYSEFVAMMQKGNAGIGRRTMRNSLNM 552 >gb|EMT26589.1| Calcium-dependent protein kinase 5 [Aegilops tauschii] Length = 558 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 524 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 554 >gb|EMT18908.1| Calcium-dependent protein kinase 5 [Aegilops tauschii] Length = 706 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 667 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 697 >gb|EMS53623.1| Calcium-dependent protein kinase 5 [Triticum urartu] Length = 461 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 427 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 457 >gb|EMS52553.1| Calcium-dependent protein kinase 5 [Triticum urartu] Length = 468 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 429 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 459 >ref|NP_001105307.1| Calcium-dependent protein kinase [Zea mays] gi|1504052|dbj|BAA13232.1| calcium-dependent protein kinase [Zea mays] Length = 554 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 515 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 545 >ref|NP_001105304.1| calcium dependent protein kinase [Zea mays] gi|1632768|dbj|BAA12338.1| calcium dependent protein kinase [Zea mays] Length = 492 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 451 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 481 >gb|AFW63436.1| putative calcium-dependent protein kinase family protein [Zea mays] Length = 562 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 522 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 552 >gb|AFW63434.1| putative calcium-dependent protein kinase family protein isoform 1 [Zea mays] gi|413923503|gb|AFW63435.1| putative calcium-dependent protein kinase family protein isoform 2 [Zea mays] Length = 198 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 158 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 188 >gb|AFV30233.1| calcium-dependent protein kinase [Triticum aestivum] Length = 559 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 520 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 550 >gb|AFR54115.1| calcium-dependent protein kinase 3-like protein, partial [Triticum aestivum] Length = 272 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 233 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 263 >ref|XP_003580397.1| PREDICTED: calcium-dependent protein kinase 4-like [Brachypodium distachyon] Length = 561 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 DGRIDYSEFVAMMTKGSTGFGRRTMRNSLNL 93 DGRIDY EFVAMMTKG+ G GRRTMRNSLN+ Sbjct: 522 DGRIDYGEFVAMMTKGNMGVGRRTMRNSLNI 552