BLASTX nr result
ID: Papaver25_contig00008323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00008323 (789 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB27045.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1... 62 2e-07 gb|EYU45725.1| hypothetical protein MIMGU_mgv1a012075mg [Mimulus... 62 2e-07 ref|XP_006484523.1| PREDICTED: succinyl-CoA ligase [ADP-forming]... 62 2e-07 ref|XP_007152547.1| hypothetical protein PHAVU_004G139300g [Phas... 62 2e-07 ref|XP_004515280.1| PREDICTED: probable succinyl-CoA ligase [ADP... 62 2e-07 ref|XP_007214592.1| hypothetical protein PRUPE_ppa024603mg, part... 62 2e-07 ref|XP_007209332.1| hypothetical protein PRUPE_ppa008341mg [Prun... 62 2e-07 gb|EYU19899.1| hypothetical protein MIMGU_mgv1a009825mg [Mimulus... 62 3e-07 ref|XP_006493424.1| PREDICTED: probable succinyl-CoA ligase [ADP... 62 3e-07 ref|XP_006441425.1| hypothetical protein CICLE_v10020931mg [Citr... 62 3e-07 ref|XP_006399319.1| hypothetical protein EUTSA_v10013993mg [Eutr... 62 3e-07 ref|XP_002318347.2| hypothetical protein POPTR_0012s033101g, par... 62 3e-07 ref|XP_003548295.1| PREDICTED: probable succinyl-CoA ligase [ADP... 62 3e-07 ref|XP_003620150.1| Succinyl-CoA ligase [Medicago truncatula] gi... 62 3e-07 ref|XP_002271746.1| PREDICTED: succinyl-CoA ligase [ADP-forming]... 62 3e-07 ref|XP_002514510.1| Succinyl-CoA ligase [GDP-forming] subunit al... 61 5e-07 ref|XP_002514509.1| Succinyl-CoA ligase [GDP-forming] subunit al... 61 5e-07 ref|XP_006348504.1| PREDICTED: succinyl-CoA ligase [ADP-forming]... 60 7e-07 ref|XP_006394592.1| hypothetical protein EUTSA_v10004347mg [Eutr... 60 7e-07 ref|XP_002307162.2| hypothetical protein POPTR_0005s09370g [Popu... 60 7e-07 >gb|EXB27045.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1 [Morus notabilis] Length = 76 Score = 62.4 bits (150), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 3 QESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 37 >gb|EYU45725.1| hypothetical protein MIMGU_mgv1a012075mg [Mimulus guttatus] Length = 262 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 190 KESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 224 >ref|XP_006484523.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial-like [Citrus sinensis] Length = 331 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 258 KESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 292 >ref|XP_007152547.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris] gi|561025856|gb|ESW24541.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris] Length = 324 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 251 KESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 285 >ref|XP_004515280.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial-like [Cicer arietinum] Length = 327 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 254 KESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 288 >ref|XP_007214592.1| hypothetical protein PRUPE_ppa024603mg, partial [Prunus persica] gi|462410457|gb|EMJ15791.1| hypothetical protein PRUPE_ppa024603mg, partial [Prunus persica] Length = 93 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 20 KESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 54 >ref|XP_007209332.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica] gi|462405067|gb|EMJ10531.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica] Length = 336 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 263 KESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 297 >gb|EYU19899.1| hypothetical protein MIMGU_mgv1a009825mg [Mimulus guttatus] Length = 330 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 258 KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 292 >ref|XP_006493424.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial-like [Citrus sinensis] Length = 347 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 274 KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 308 >ref|XP_006441425.1| hypothetical protein CICLE_v10020931mg [Citrus clementina] gi|557543687|gb|ESR54665.1| hypothetical protein CICLE_v10020931mg [Citrus clementina] Length = 347 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 274 KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 308 >ref|XP_006399319.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum] gi|557100409|gb|ESQ40772.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum] Length = 347 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 273 KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 307 >ref|XP_002318347.2| hypothetical protein POPTR_0012s033101g, partial [Populus trichocarpa] gi|550326292|gb|EEE96567.2| hypothetical protein POPTR_0012s033101g, partial [Populus trichocarpa] Length = 192 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 119 KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 153 >ref|XP_003548295.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial-like [Glycine max] Length = 325 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 252 KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 286 >ref|XP_003620150.1| Succinyl-CoA ligase [Medicago truncatula] gi|355495165|gb|AES76368.1| Succinyl-CoA ligase [Medicago truncatula] Length = 323 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 250 KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 284 >ref|XP_002271746.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial [Vitis vinifera] gi|296085314|emb|CBI29046.3| unnamed protein product [Vitis vinifera] Length = 329 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 256 KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 290 >ref|XP_002514510.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial precursor, putative [Ricinus communis] gi|223546409|gb|EEF47910.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial precursor, putative [Ricinus communis] Length = 334 Score = 60.8 bits (146), Expect = 5e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG +KPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 261 KESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 295 >ref|XP_002514509.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial precursor, putative [Ricinus communis] gi|223546408|gb|EEF47909.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial precursor, putative [Ricinus communis] Length = 334 Score = 60.8 bits (146), Expect = 5e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG +KPIVA IAGL APPGRRMGHAGAIVS GK Sbjct: 261 KESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGK 295 >ref|XP_006348504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial-like [Solanum tuberosum] Length = 332 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG +KP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 260 KESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 294 >ref|XP_006394592.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum] gi|557091231|gb|ESQ31878.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum] Length = 401 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG +KP+VA IAGL APPGRRMGHAGAIVS GK Sbjct: 328 KESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGK 362 >ref|XP_002307162.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa] gi|550338470|gb|EEE94158.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa] Length = 331 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 162 EESGPEKPIVALIAGLKAPPGRRMGHAGAIVSRGK 58 +ESG EKP+VA IAG+ APPGRRMGHAGAIVS GK Sbjct: 258 KESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGK 292