BLASTX nr result
ID: Papaver25_contig00008151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00008151 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21530.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002279217.1| PREDICTED: uncharacterized mitochondrial car... 71 1e-10 emb|CAN62817.1| hypothetical protein VITISV_031886 [Vitis vinifera] 71 1e-10 gb|EXB24794.1| hypothetical protein L484_005173 [Morus notabilis] 71 2e-10 ref|XP_002524353.1| mitochondrial carrier protein, putative [Ric... 71 2e-10 ref|XP_002306360.2| mitochondrial substrate carrier family prote... 70 4e-10 ref|XP_006285873.1| hypothetical protein CARUB_v10007368mg [Caps... 69 7e-10 ref|XP_006441382.1| hypothetical protein CICLE_v10021207mg [Citr... 68 1e-09 ref|XP_006842198.1| hypothetical protein AMTR_s00078p00165690 [A... 68 1e-09 ref|XP_002868906.1| predicted protein [Arabidopsis lyrata subsp.... 68 1e-09 ref|NP_568060.1| S-adenosylmethionine carrier 1 [Arabidopsis tha... 68 1e-09 ref|XP_004288103.1| PREDICTED: S-adenosylmethionine mitochondria... 68 2e-09 ref|XP_007205556.1| hypothetical protein PRUPE_ppa008636mg [Prun... 68 2e-09 ref|XP_006367413.1| PREDICTED: S-adenosylmethionine mitochondria... 67 3e-09 ref|XP_007019619.1| S-adenosylmethionine carrier 2 [Theobroma ca... 67 3e-09 ref|XP_004237475.1| PREDICTED: uncharacterized mitochondrial car... 67 3e-09 ref|XP_004172350.1| PREDICTED: uncharacterized mitochondrial car... 66 4e-09 ref|XP_004148454.1| PREDICTED: uncharacterized mitochondrial car... 66 4e-09 ref|XP_002884764.1| predicted protein [Arabidopsis lyrata subsp.... 66 4e-09 ref|XP_006466113.1| PREDICTED: S-adenosylmethionine carrier 1, c... 66 6e-09 >emb|CBI21530.3| unnamed protein product [Vitis vinifera] Length = 366 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEESFKKD 146 ALLKGIGPRVLWIGIGGSIFFGVLERTK LAQRR +S K+D Sbjct: 319 ALLKGIGPRVLWIGIGGSIFFGVLERTKRALAQRRPSPNQHSDSPKQD 366 >ref|XP_002279217.1| PREDICTED: uncharacterized mitochondrial carrier YMR166C-like [Vitis vinifera] Length = 327 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEESFKKD 146 ALLKGIGPRVLWIGIGGSIFFGVLERTK LAQRR +S K+D Sbjct: 280 ALLKGIGPRVLWIGIGGSIFFGVLERTKRALAQRRPSPNQHSDSPKQD 327 >emb|CAN62817.1| hypothetical protein VITISV_031886 [Vitis vinifera] Length = 357 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEESFKKD 146 ALLKGIGPRVLWIGIGGSIFFGVLERTK LAQRR +S K+D Sbjct: 310 ALLKGIGPRVLWIGIGGSIFFGVLERTKRALAQRRPSPNQHSDSPKQD 357 >gb|EXB24794.1| hypothetical protein L484_005173 [Morus notabilis] Length = 213 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEESFKKD 146 ALLKGIGPRVLWIGIGGSIFFGVLE TK LLAQRR P++ KKD Sbjct: 169 ALLKGIGPRVLWIGIGGSIFFGVLESTKRLLAQRR---PIPQQDSKKD 213 >ref|XP_002524353.1| mitochondrial carrier protein, putative [Ricinus communis] gi|223536444|gb|EEF38093.1| mitochondrial carrier protein, putative [Ricinus communis] Length = 328 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/48 (70%), Positives = 38/48 (79%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEESFKKD 146 ALLKGIGPRVLWIGIGGSIFFGVLE+TK ++AQR G FK+D Sbjct: 281 ALLKGIGPRVLWIGIGGSIFFGVLEKTKQMIAQRCPGSTMKSAPFKQD 328 >ref|XP_002306360.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550338430|gb|EEE93356.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 312 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRR 107 ALLKGIGPRVLWIGIGGSIFFGVLERTK LLAQRR Sbjct: 266 ALLKGIGPRVLWIGIGGSIFFGVLERTKRLLAQRR 300 >ref|XP_006285873.1| hypothetical protein CARUB_v10007368mg [Capsella rubella] gi|482554578|gb|EOA18771.1| hypothetical protein CARUB_v10007368mg [Capsella rubella] Length = 324 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 2/45 (4%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDG--KQTPEE 131 ALLKGIGPRVLWIGIGGSIFFGVLERTK LAQRR K++ EE Sbjct: 280 ALLKGIGPRVLWIGIGGSIFFGVLERTKRTLAQRRPNTVKESKEE 324 >ref|XP_006441382.1| hypothetical protein CICLE_v10021207mg [Citrus clementina] gi|567897790|ref|XP_006441383.1| hypothetical protein CICLE_v10021207mg [Citrus clementina] gi|557543644|gb|ESR54622.1| hypothetical protein CICLE_v10021207mg [Citrus clementina] gi|557543645|gb|ESR54623.1| hypothetical protein CICLE_v10021207mg [Citrus clementina] Length = 320 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRR 107 ALLKGIGPRV+WIGIGGSIFFGVLERTK +LAQRR Sbjct: 276 ALLKGIGPRVMWIGIGGSIFFGVLERTKRMLAQRR 310 >ref|XP_006842198.1| hypothetical protein AMTR_s00078p00165690 [Amborella trichopoda] gi|548844247|gb|ERN03873.1| hypothetical protein AMTR_s00078p00165690 [Amborella trichopoda] Length = 313 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQR 104 ALLKGIGPRVLWIGIGGSIFFGVLERTKL+L+QR Sbjct: 273 ALLKGIGPRVLWIGIGGSIFFGVLERTKLILSQR 306 >ref|XP_002868906.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314742|gb|EFH45165.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 325 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/45 (80%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDG--KQTPEE 131 ALLKGIGPRVLWIGIGGSIFFGVLE TK LAQRR K+T EE Sbjct: 281 ALLKGIGPRVLWIGIGGSIFFGVLESTKRTLAQRRPNTVKETKEE 325 >ref|NP_568060.1| S-adenosylmethionine carrier 1 [Arabidopsis thaliana] gi|334187328|ref|NP_001190968.1| S-adenosylmethionine carrier 1 [Arabidopsis thaliana] gi|75306330|sp|Q94AG6.1|SAMC1_ARATH RecName: Full=S-adenosylmethionine carrier 1, chloroplastic/mitochondrial; AltName: Full=S-adenosylmethionine transporter 1; Short=AtSAMT1; Flags: Precursor gi|15028275|gb|AAK76726.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|19310699|gb|AAL85080.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|117585040|emb|CAJ91123.1| S-adenosylmethionine carrier [Arabidopsis thaliana] gi|119391877|emb|CAF29517.1| S-adenosylmethionine transporter [Arabidopsis thaliana] gi|332661674|gb|AEE87074.1| S-adenosylmethionine carrier 1 [Arabidopsis thaliana] gi|332661675|gb|AEE87075.1| S-adenosylmethionine carrier 1 [Arabidopsis thaliana] Length = 325 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/45 (80%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDG--KQTPEE 131 ALLKGIGPRVLWIGIGGSIFFGVLE TK LAQRR K+T EE Sbjct: 281 ALLKGIGPRVLWIGIGGSIFFGVLESTKRTLAQRRPNTVKETKEE 325 >ref|XP_004288103.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like [Fragaria vesca subsp. vesca] Length = 327 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/45 (77%), Positives = 38/45 (84%), Gaps = 2/45 (4%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRD--GKQTPEE 131 ALLKGIGPRVLWIGIGGSIFFGVLERTK LLAQ R G+ T ++ Sbjct: 283 ALLKGIGPRVLWIGIGGSIFFGVLERTKRLLAQSRPKVGEDTKQD 327 >ref|XP_007205556.1| hypothetical protein PRUPE_ppa008636mg [Prunus persica] gi|462401198|gb|EMJ06755.1| hypothetical protein PRUPE_ppa008636mg [Prunus persica] Length = 324 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEES 134 ALLKGIGPRVLWIGIGGSIFFGVLERTK L+QRR PE+S Sbjct: 280 ALLKGIGPRVLWIGIGGSIFFGVLERTKRFLSQRR--PTLPEDS 321 >ref|XP_006367413.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like [Solanum tuberosum] Length = 326 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEE 131 ALLKGIGPRVLWIGIGGSIFFGVLERTK LAQ R T ++ Sbjct: 283 ALLKGIGPRVLWIGIGGSIFFGVLERTKRYLAQNRPDNATSKK 325 >ref|XP_007019619.1| S-adenosylmethionine carrier 2 [Theobroma cacao] gi|508724947|gb|EOY16844.1| S-adenosylmethionine carrier 2 [Theobroma cacao] Length = 326 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEESFKKD 146 ALLKGIGPRVLWIG+GGSIFFGVLE+TK +LA+RR Q SFK++ Sbjct: 280 ALLKGIGPRVLWIGLGGSIFFGVLEKTKQMLAERRPENQ-KSFSFKQN 326 >ref|XP_004237475.1| PREDICTED: uncharacterized mitochondrial carrier C12B10.09-like [Solanum lycopersicum] Length = 326 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDGKQTPEE 131 ALLKGIGPRVLWIGIGGSIFFGVLERTK LAQ R T ++ Sbjct: 283 ALLKGIGPRVLWIGIGGSIFFGVLERTKRYLAQNRPDNATSKK 325 >ref|XP_004172350.1| PREDICTED: uncharacterized mitochondrial carrier C12B10.09-like, partial [Cucumis sativus] Length = 247 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRR 107 ALLKGIGPRVLWIGIGGSIFFGVLE TK LLA+RR Sbjct: 203 ALLKGIGPRVLWIGIGGSIFFGVLESTKRLLAERR 237 >ref|XP_004148454.1| PREDICTED: uncharacterized mitochondrial carrier C12B10.09-like [Cucumis sativus] Length = 306 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRR 107 ALLKGIGPRVLWIGIGGSIFFGVLE TK LLA+RR Sbjct: 262 ALLKGIGPRVLWIGIGGSIFFGVLESTKRLLAERR 296 >ref|XP_002884764.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330604|gb|EFH61023.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 87 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/44 (79%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRRDG--KQTPE 128 ALLKGIGPRVLWIGIGGSIFFGVLE TK LAQRR K+T E Sbjct: 44 ALLKGIGPRVLWIGIGGSIFFGVLESTKRTLAQRRPNTVKETKE 87 >ref|XP_006466113.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X1 [Citrus sinensis] gi|568823423|ref|XP_006466114.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X2 [Citrus sinensis] gi|568823425|ref|XP_006466115.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X3 [Citrus sinensis] gi|568823427|ref|XP_006466116.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X4 [Citrus sinensis] gi|568823429|ref|XP_006466117.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X5 [Citrus sinensis] Length = 320 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 ALLKGIGPRVLWIGIGGSIFFGVLERTKLLLAQRR 107 ALLKGIGPRV+WIGIGGSIFFGVLE TK +LAQRR Sbjct: 276 ALLKGIGPRVMWIGIGGSIFFGVLESTKRMLAQRR 310