BLASTX nr result
ID: Papaver25_contig00007707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00007707 (1887 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213052.1| hypothetical protein PRUPE_ppa020415mg, part... 59 8e-06 >ref|XP_007213052.1| hypothetical protein PRUPE_ppa020415mg, partial [Prunus persica] gi|462408917|gb|EMJ14251.1| hypothetical protein PRUPE_ppa020415mg, partial [Prunus persica] Length = 840 Score = 58.9 bits (141), Expect = 8e-06 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 3/92 (3%) Frame = +2 Query: 1619 KMDEYPNIGQRNKLFRGF--VNGSVCRFTIDGSCIDNLVSRKMVEAKGLEMDWYPHPDQI 1792 +++E P GQRN +FR + +C +D +N VS+K+VE L + + P + Sbjct: 107 ELEEPPPEGQRNSIFRSLCSIKNKICDVIVDNGSCENFVSKKLVERLQLPTEPHISPYSL 166 Query: 1793 ECSSKG-SITCVGVCRFPLSFGKVYFDSIICE 1885 +KG S+ V C PLS GK Y D ++C+ Sbjct: 167 GWVNKGPSVRVVETCHVPLSIGKHYRDDVVCD 198