BLASTX nr result
ID: Papaver25_contig00007075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00007075 (834 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527362.1| E3 ubiquitin protein ligase upl2, putative [... 58 4e-06 ref|XP_007018282.1| E3 ubiquitin-protein ligase UPL2 isoform 2 [... 57 8e-06 ref|XP_007018281.1| E3 ubiquitin-protein ligase UPL2 isoform 1 [... 57 8e-06 >ref|XP_002527362.1| E3 ubiquitin protein ligase upl2, putative [Ricinus communis] gi|223533281|gb|EEF35034.1| E3 ubiquitin protein ligase upl2, putative [Ricinus communis] Length = 3666 Score = 58.2 bits (139), Expect = 4e-06 Identities = 29/59 (49%), Positives = 36/59 (61%) Frame = +3 Query: 318 EVTML*ERVEHRYHGRALFAMHPRNRKGESSRRGDALGLIGSTPMGKGDERGVA*KLFD 494 E ML ER HRYH R LF M+PR+R+GESSRRG+ +G G G R + KL + Sbjct: 2689 EANMLRERFAHRYHNRTLFGMYPRSRRGESSRRGEGIG-YSLERAGTGSRRSITTKLVE 2746 >ref|XP_007018282.1| E3 ubiquitin-protein ligase UPL2 isoform 2 [Theobroma cacao] gi|590596240|ref|XP_007018283.1| E3 ubiquitin-protein ligase UPL2 isoform 2 [Theobroma cacao] gi|590596243|ref|XP_007018284.1| E3 ubiquitin-protein ligase UPL2 isoform 2 [Theobroma cacao] gi|508723610|gb|EOY15507.1| E3 ubiquitin-protein ligase UPL2 isoform 2 [Theobroma cacao] gi|508723611|gb|EOY15508.1| E3 ubiquitin-protein ligase UPL2 isoform 2 [Theobroma cacao] gi|508723612|gb|EOY15509.1| E3 ubiquitin-protein ligase UPL2 isoform 2 [Theobroma cacao] Length = 3034 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +3 Query: 318 EVTML*ERVEHRYHGRALFAMHPRNRKGESSRRGDALG 431 E ML ER HRYH RALF M+PRNR+GESSRR + +G Sbjct: 2707 EANMLRERFAHRYHNRALFGMYPRNRRGESSRRSEGIG 2744 >ref|XP_007018281.1| E3 ubiquitin-protein ligase UPL2 isoform 1 [Theobroma cacao] gi|508723609|gb|EOY15506.1| E3 ubiquitin-protein ligase UPL2 isoform 1 [Theobroma cacao] Length = 3674 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +3 Query: 318 EVTML*ERVEHRYHGRALFAMHPRNRKGESSRRGDALG 431 E ML ER HRYH RALF M+PRNR+GESSRR + +G Sbjct: 2707 EANMLRERFAHRYHNRALFGMYPRNRRGESSRRSEGIG 2744