BLASTX nr result
ID: Papaver25_contig00004802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00004802 (571 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285074.2| PREDICTED: putative cyclin-A3-1-like isoform... 62 1e-07 emb|CAA63541.1| cyclin A-like protein [Nicotiana tabacum] 59 7e-07 dbj|BAA20410.1| A-type cyclin [Catharanthus roseus] 59 9e-07 ref|XP_006362078.1| PREDICTED: cyclin-A3-2-like [Solanum tuberosum] 58 2e-06 ref|XP_004238117.1| PREDICTED: cyclin-A3-2-like [Solanum lycoper... 58 2e-06 ref|XP_003578446.1| PREDICTED: cyclin-A3-2-like [Brachypodium di... 56 6e-06 ref|XP_002442399.1| hypothetical protein SORBIDRAFT_08g019410 [S... 56 6e-06 gb|EYU36354.1| hypothetical protein MIMGU_mgv1a008278mg [Mimulus... 56 8e-06 ref|XP_002510134.1| cyclin A, putative [Ricinus communis] gi|223... 56 8e-06 >ref|XP_002285074.2| PREDICTED: putative cyclin-A3-1-like isoform 1 [Vitis vinifera] gi|302142243|emb|CBI19446.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFEDVE 470 LVAVR+KYKQHKFKCV+TL+SPS IP++YFED++ Sbjct: 331 LVAVREKYKQHKFKCVATLSSPSVIPVSYFEDIK 364 >emb|CAA63541.1| cyclin A-like protein [Nicotiana tabacum] Length = 384 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFEDV 473 L AVRDKYKQHKFKCVS+LTSP EIP ++FED+ Sbjct: 349 LAAVRDKYKQHKFKCVSSLTSPVEIPASFFEDM 381 >dbj|BAA20410.1| A-type cyclin [Catharanthus roseus] Length = 372 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFEDV 473 LVAVRDKYKQHKFKCVSTLT+P IP +FED+ Sbjct: 340 LVAVRDKYKQHKFKCVSTLTAPPSIPDEFFEDI 372 >ref|XP_006362078.1| PREDICTED: cyclin-A3-2-like [Solanum tuberosum] Length = 368 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFED 476 LVAVRDKYKQHKFKCVSTLTS EIP ++FED Sbjct: 333 LVAVRDKYKQHKFKCVSTLTSLVEIPASFFED 364 >ref|XP_004238117.1| PREDICTED: cyclin-A3-2-like [Solanum lycopersicum] Length = 371 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFED 476 LVAVRDKYKQHKFKCVSTLTS EIP ++FED Sbjct: 336 LVAVRDKYKQHKFKCVSTLTSLVEIPASFFED 367 >ref|XP_003578446.1| PREDICTED: cyclin-A3-2-like [Brachypodium distachyon] Length = 381 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFEDVE 470 L A+RDKYKQH+FKCVSTL P EIP +YF+D E Sbjct: 348 LTAIRDKYKQHRFKCVSTLLPPVEIPASYFQDSE 381 >ref|XP_002442399.1| hypothetical protein SORBIDRAFT_08g019410 [Sorghum bicolor] gi|241943092|gb|EES16237.1| hypothetical protein SORBIDRAFT_08g019410 [Sorghum bicolor] Length = 428 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFEDVE 470 L+A+RDKYKQHKFKCVSTL P IP +YFED++ Sbjct: 394 LMAIRDKYKQHKFKCVSTLLPPVVIPASYFEDLD 427 >gb|EYU36354.1| hypothetical protein MIMGU_mgv1a008278mg [Mimulus guttatus] Length = 379 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFE 479 LVAVRDKYKQHKFKCVS LT PSEIP ++F+ Sbjct: 343 LVAVRDKYKQHKFKCVSELTPPSEIPESFFD 373 >ref|XP_002510134.1| cyclin A, putative [Ricinus communis] gi|223550835|gb|EEF52321.1| cyclin A, putative [Ricinus communis] Length = 373 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 571 LVAVRDKYKQHKFKCVSTLTSPSEIPIAYFEDV 473 L AVR+KYKQHKFKCV+T+ SP EIP AYFE V Sbjct: 339 LQAVREKYKQHKFKCVATMPSPPEIPAAYFEGV 371